Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	635
Gene name Gene Name - the full gene name approved by the HGNC.	Betaine--homocysteine S-methyltransferase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BHMT
Synonyms (NCBI Gene) Gene synonyms aliases	BHMT1, HEL-S-61p
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in this gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed. [provid

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments
MIRT821361	hsa-miR-103a	CLIP-seq
MIRT821362	hsa-miR-107	CLIP-seq
MIRT821363	hsa-miR-1914	CLIP-seq
MIRT821364	hsa-miR-3074-5p	CLIP-seq
MIRT821365	hsa-miR-3944-5p	CLIP-seq
MIRT821366	hsa-miR-4519	CLIP-seq
MIRT821367	hsa-miR-587	CLIP-seq
MIRT1942807	hsa-miR-4650-3p	CLIP-seq
MIRT1942807	hsa-miR-4650-3p	CLIP-seq
MIRT2181567	hsa-miR-4796-3p	CLIP-seq
MIRT2181568	hsa-miR-548t	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
NFKB1	Repression	16953798
RELA	Repression	16953798

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006479	Process	Protein methylation	NAS	10075673
GO:0006575	Process	Modified amino acid metabolic process	IEA
GO:0006577	Process	Amino-acid betaine metabolic process	IDA	18230605
GO:0006579	Process	Amino-acid betaine catabolic process	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008172	Function	S-methyltransferase activity	IEA
GO:0008270	Function	Zinc ion binding	IDA	12220488, 18230605
GO:0008270	Function	Zinc ion binding	IEA
GO:0009086	Process	Methionine biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0046500	Process	S-adenosylmethionine metabolic process	IDA	18230605
GO:0046872	Function	Metal ion binding	IEA
GO:0047150	Function	Betaine-homocysteine S-methyltransferase activity	IBA
GO:0047150	Function	Betaine-homocysteine S-methyltransferase activity	IDA	8798461, 9681996, 10529246, 18230605
GO:0047150	Function	Betaine-homocysteine S-methyltransferase activity	IEA
GO:0047150	Function	Betaine-homocysteine S-methyltransferase activity	NAS	10075673
GO:0050666	Process	Regulation of homocysteine metabolic process	NAS	10075673
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070062	Component	Extracellular exosome	IDA	21082674
GO:0071266	Process	'de novo' L-methionine biosynthetic process	IMP	10529246
GO:0071267	Process	L-methionine salvage	IBA
GO:0071267	Process	L-methionine salvage	IDA	18230605
GO:0071267	Process	L-methionine salvage	IEA

MIM	HGNC	e!Ensembl
602888	1047	ENSG00000145692

Protein

UniProt ID

Q93088

Protein name

Betaine--homocysteine S-methyltransferase 1 (EC 2.1.1.5)

Protein function

Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline. {ECO:0000269|PubMed:10529246, ECO

PDB

1LT7 , 1LT8 , 4M3P , 8D45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02574	S-methyl_trans	23 → 314	Homocysteine S-methyltransferase	Family

Tissue specificity

TISSUE SPECIFICITY: Found exclusively in liver and kidney. {ECO:0000269|PubMed:9281325}.

Sequence

MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQEVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFLQQLEVFMKKNVDFLIAEYFEHVEEAVWAVETLIASGKP
VAATMCIGPEGDLHGVPPGECAVRLVKAGASIIGVNCHFDPTISLKTVKLMKEGLEAARL
KAHLMSQPLAYHTPDCNKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLDMHTKPWVRARARKEYWENLRIASG
RPYNPSMSKPDGWGVTKGTAELMQQKEATTEQQLKELFEKQKFKSQ

Sequence length

406

Interactions

View interactions

	KEGG		Reactome
	Glycine, serine and threonine metabolism Cysteine and methionine metabolism One carbon pool by folate Metabolic pathways Folate transport and metabolism		Sulfur amino acid metabolism Choline catabolism

BHMT (betaine--homocysteine S-methyltransferase)