CCL3 (C-C motif chemokine ligand 3)

Gene

• Entrez ID: 6348
• Gene name: C-C motif chemokine ligand 3
• Gene symbol: CCL3
• Synonyms (NCBI Gene): G0S19-1, LD78, LD78ALPHA, MIP-1-alpha, MIP1A, SCI, SCYA3
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be a

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT438283	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT438283	hsa-miR-223-3p	Luciferase reporter assay	24084739
MIRT736396	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT756279	hsa-miR-877-3p	qRT-PCR, ELISA	34768991

Transcription factors

Transcription factor	Regulation	Reference
E2F1	Unknown	17707233
NFKB1	Activation	16982926
NFKB1	Unknown	11342414;17707233
RELA	Activation	16982926
RELA	Unknown	11342414;17707233
RUNX1	Activation	12771199
STAT1	Activation	16628196

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEP	12032188
GO:0001649	Process	Osteoblast differentiation	IEP	21403648
GO:0001775	Process	Cell activation	IDA	10706735
GO:0002548	Process	Monocyte chemotaxis	IC	10660125
GO:0002548	Process	Monocyte chemotaxis	IDA	10706735
GO:0004672	Function	Protein kinase activity	IDA	10734056
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	20959807, 21784977, 26095031, 32296183
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	20167378, 21403648
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IDA	21784977
GO:0005829	Component	Cytosol	IDA	19523456
GO:0006816	Process	Calcium ion transport	IDA	10734056
GO:0006874	Process	Intracellular calcium ion homeostasis	IDA	10072545, 10734056, 21403648
GO:0006887	Process	Exocytosis	IDA	10734056
GO:0006935	Process	Chemotaxis	IDA	10679098
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IDA	10679098, 10706735
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IEA
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007267	Process	Cell-cell signaling	IDA	10679098
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	10072545, 10660125
GO:0008009	Function	Chemokine activity	IEA
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009636	Process	Response to toxic substance	IDA	10841574
GO:0010628	Process	Positive regulation of gene expression	IDA	10706735
GO:0010629	Process	Negative regulation of gene expression	IDA	21403648
GO:0010818	Process	T cell chemotaxis	IDA	10706735
GO:0014808	Process	Release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	19523456
GO:0016004	Function	Phospholipase activator activity	IDA	10734056
GO:0016301	Function	Kinase activity	IDA	21403648
GO:0019722	Process	Calcium-mediated signaling	IDA	10072545, 19523456
GO:0023052	Process	Signaling	IEP	12032188
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IDA	7545673, 10706735
GO:0030502	Process	Negative regulation of bone mineralization	IDA	21403648
GO:0030593	Process	Neutrophil chemotaxis	IDA	10706735
GO:0031726	Function	CCR1 chemokine receptor binding	IPI	7545673, 8699119, 10660125, 15764707
GO:0031730	Function	CCR5 chemokine receptor binding	IPI	8699119, 10679098
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISS
GO:0032760	Process	Positive regulation of tumor necrosis factor production	ISS
GO:0042056	Function	Chemoattractant activity	IDA	10072545, 10660125, 10706735, 15001559
GO:0042802	Function	Identical protein binding	IPI	20959807
GO:0043308	Process	Eosinophil degranulation	IDA	10706735
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0043615	Process	Astrocyte cell migration	ISS
GO:0043922	Process	Host-mediated suppression of viral transcription	IDA	10841574
GO:0045671	Process	Negative regulation of osteoclast differentiation	IDA	21403648
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IDA	10072545
GO:0048246	Process	Macrophage chemotaxis	ISS
GO:0048247	Process	Lymphocyte chemotaxis	IDA	10706735
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050795	Process	Regulation of behavior	IDA	20167378
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IMP	10679098
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEP	21403648
GO:0051928	Process	Positive regulation of calcium ion transport	IDA	8699119, 15764707
GO:0051930	Process	Regulation of sensory perception of pain	IDA	15764707
GO:0060326	Process	Cell chemotaxis	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	21403648
GO:0070723	Process	Response to cholesterol	IDA	19523456
GO:0071346	Process	Cellular response to type II interferon	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0071621	Process	Granulocyte chemotaxis	IDA	10706735
GO:0090280	Process	Positive regulation of calcium ion import	TAS	10925302
GO:1903980	Process	Positive regulation of microglial cell activation	TAS	29518356
GO:1904141	Process	Positive regulation of microglial cell migration	TAS	29518356
GO:2000503	Process	Positive regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 182283
• HGNC: 10627
• e!Ensembl: ENSG00000277632

Protein

• UniProt ID: P10147
• Protein name: C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alph
• Protein function: Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, H
• PDB: 1B50, 1B53, 2X69, 2X6G, 3FPU, 3H44, 3KBX, 4RA8, 4ZKB, 5COR, 5D65, 7F1Q, 7F1T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
  GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

• Sequence length: 92

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
Toll-like receptor signaling pathway
Chagas disease
Human cytomegalovirus infection
Rheumatoid arthritis
Lipid and atherosclerosis

Reactome:

Chemokine receptors bind chemokines
Interleukin-10 signaling