CCL2 (C-C motif chemokine ligand 2)

Gene

• Entrez ID: 6347
• Gene name: C-C motif chemokine ligand 2
• Gene symbol: CCL2
• Synonyms (NCBI Gene): GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the ar

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay	19404929
MIRT021047	hsa-miR-155-5p	Proteomics	18668040
MIRT024058	hsa-miR-1-3p	Microarray	18668037
MIRT030277	hsa-miR-26b-5p	Microarray	19088304
MIRT030558	hsa-miR-24-3p	Microarray	19748357
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT004284	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24122720
MIRT731131	hsa-miR-495-3p	ELISA, qRT-PCR, Luciferase reporter assay, Western blot	25466836
MIRT731131	hsa-miR-495-3p	ELISA, qRT-PCR, Luciferase reporter assay, Western blot	25466836
MIRT732272	hsa-miR-518a-5p	ELISA, qRT-PCR, Western blot	28341837
MIRT732272	hsa-miR-518a-5p	ELISA, qRT-PCR, Western blot	28341837
MIRT024058	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT024058	hsa-miR-1-3p	ELISA, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27541266
MIRT732726	hsa-miR-550a-3-5p	Immunohistochemistry (IHC), Microarray, qRT-PCR, Western blotting	32493454
MIRT735937	hsa-miR-493-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33332775
MIRT755529	hsa-miR-149-3p	qRT-PCR	36250208
MIRT756186	hsa-miR-146a-5p	Western blotting, qRT-PCR	36409752
MIRT871036	hsa-miR-1323	CLIP-seq
MIRT871037	hsa-miR-3667-5p	CLIP-seq
MIRT871038	hsa-miR-371b-5p	CLIP-seq
MIRT871039	hsa-miR-527	CLIP-seq
MIRT871040	hsa-miR-548o	CLIP-seq
MIRT2427164	hsa-miR-3143	CLIP-seq
MIRT2427165	hsa-miR-543	CLIP-seq
MIRT2427166	hsa-miR-664	CLIP-seq
MIRT2498638	hsa-miR-124	CLIP-seq
MIRT2498639	hsa-miR-23a	CLIP-seq
MIRT2498640	hsa-miR-23b	CLIP-seq
MIRT2498641	hsa-miR-23c	CLIP-seq
MIRT2498642	hsa-miR-3714	CLIP-seq
MIRT2498643	hsa-miR-3910	CLIP-seq
MIRT2498644	hsa-miR-409-3p	CLIP-seq
MIRT2498645	hsa-miR-506	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
APEX1	Activation	17045925
ATF4	Unknown	16931790
CEBPA	Activation	24429361
HDAC2	Unknown	22679019
IRF3	Unknown	20483755
JUN	Activation	18443042
NFAT5	Repression	22619484
NFIC	Activation	16206198
NFKB1	Activation	10530453;11512674;12488502;12647268;16206198;16764699;20200316;9388261
NFKB1	Unknown	10744656;11006087;11949945;12218154;14631383;15950427;16040075;16818736;8617886
NR1I2	Repression	22248096
PREB	Unknown	19426980
REL	Activation	10469356;9388261
RELA	Activation	10530453;12488502;12647268;16206198;16764699;17452470;20200316;9388261
RELA	Unknown	10744656;11006087;11949945;12218154;14631383;15950427;16040075;16730843;16818736;8617886
SP1	Activation	10644332
SP1	Unknown	12488502
SPI1	Activation	24429361
STAT1	Unknown	12388243;17167270
STAT2	Unknown	17167270
STAT3	Activation	24429361
XBP1	Unknown	16931790

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IMP	21147091
GO:0001525	Process	Angiogenesis	TAS	18334747
GO:0002548	Process	Monocyte chemotaxis	IBA	21873635
GO:0002548	Process	Monocyte chemotaxis	IDA	12207323
GO:0004672	Function	Protein kinase activity	TAS	9973507
GO:0005102	Function	Signaling receptor binding	TAS	10542238
GO:0005515	Function	Protein binding	IPI	26095031, 28381538, 32296183
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006468	Process	Protein phosphorylation	TAS	9670957
GO:0006935	Process	Chemotaxis	TAS	10623817
GO:0006954	Process	Inflammatory response	IBA	21873635
GO:0006954	Process	Inflammatory response	IDA	21147091
GO:0006959	Process	Humoral immune response	TAS	9548499
GO:0007010	Process	Cytoskeleton organization	IDA	10072545
GO:0007155	Process	Cell adhesion	TAS	10198043
GO:0007165	Process	Signal transduction	NAS	10770925
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9548499
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	10770925
GO:0007259	Process	Receptor signaling pathway via JAK-STAT	TAS	9670957
GO:0008009	Function	Chemokine activity	IBA	21873635
GO:0008360	Process	Regulation of cell shape	IDA	10072545
GO:0009617	Process	Response to bacterium	NAS	16034137
GO:0009887	Process	Animal organ morphogenesis	TAS	9364936
GO:0019079	Process	Viral genome replication	TAS	10985244
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	12207323
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019725	Process	Cellular homeostasis	TAS	18334747
GO:0030593	Process	Neutrophil chemotaxis	IBA	21873635
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IDA	21147091
GO:0031727	Function	CCR2 chemokine receptor binding	ISS
GO:0031727	Function	CCR2 chemokine receptor binding	TAS	18021937
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IDA	12753088
GO:0035684	Process	Helper T cell extravasation	ISS
GO:0036499	Process	PERK-mediated unfolded protein response	TAS
GO:0043491	Process	Protein kinase B signaling	IMP	21147091
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	12753088
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043615	Process	Astrocyte cell migration	IDA	12271471
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEP	9407497
GO:0048020	Function	CCR chemokine receptor binding	IBA	21873635
GO:0048245	Process	Eosinophil chemotaxis	IBA	21873635
GO:0048246	Process	Macrophage chemotaxis	IDA	12207323
GO:0048247	Process	Lymphocyte chemotaxis	IBA	21873635
GO:0050870	Process	Positive regulation of T cell activation	ISS
GO:0051770	Process	Positive regulation of nitric-oxide synthase biosynthetic process	ISS
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	ISS
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071346	Process	Cellular response to interferon-gamma	IBA	21873635
GO:0071346	Process	Cellular response to interferon-gamma	IEP	9407497
GO:0071346	Process	Cellular response to interferon-gamma	ISS
GO:0071347	Process	Cellular response to interleukin-1	IBA	21873635
GO:0071347	Process	Cellular response to interleukin-1	IEP	9407497
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071356	Process	Cellular response to tumor necrosis factor	IBA	21873635
GO:0071356	Process	Cellular response to tumor necrosis factor	IEP	9407497
GO:0071356	Process	Cellular response to tumor necrosis factor	ISS
GO:0071407	Process	Cellular response to organic cyclic compound	IDA	21147091
GO:0090280	Process	Positive regulation of calcium ion import	IDA	10925302
GO:1904783	Process	Positive regulation of NMDA glutamate receptor activity	ISS
GO:1905563	Process	Negative regulation of vascular endothelial cell proliferation	IMP	25466836
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IMP	25466836
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	25466836
GO:2000427	Process	Positive regulation of apoptotic cell clearance	ISS
GO:2000502	Process	Negative regulation of natural killer cell chemotaxis	IDA	7545673

Other IDs

• MIM: 158105
• HGNC: 10618
• e!Ensembl: ENSG00000108691

Protein

• UniProt ID: P13500
• Protein name: C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
• Protein function: Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:10529171, PubMed:10587439, PubMed:9837883). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:
• PDB: 1DOK, 1DOL, 1DOM, 1DON, 1ML0, 2BDN, 2NZ1, 3IFD, 4DN4, 4R8I, 4ZK9, 7SO0, 7XA3, 8FJ0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	32 → 90	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the seminal plasma, endometrial fluid and follicular fluid (at protein level) (PubMed:23765988). Expressed in monocytes (PubMed:2513477). {ECO:0000269|PubMed:23765988, ECO:0000269|PubMed:2513477}.
• Sequence:

  MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
  KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT

• Sequence length: 99

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway
NOD-like receptor signaling pathway
IL-17 signaling pathway
TNF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Yersinia infection
Chagas disease
Malaria
Human cytomegalovirus infection
Influenza A
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
Rheumatoid arthritis
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Chemokine receptors bind chemokines
ATF4 activates genes in response to endoplasmic reticulum stress
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Anencephaly	Anencephaly, Iniencephaly, Exencephaly	rs773607884
Becker muscular dystrophy	Becker Muscular Dystrophy	rs104894787, rs1569564916, rs1569546198, rs128626236, rs128626237, rs1556834513, rs2147483647, rs267606771, rs5030730, rs587776747, rs398122853, rs398123935, rs398123954, rs398123985, rs398124002, rs398124034, rs398124082, rs398124099, rs398124105, rs373286166, rs727503864, rs796065325, rs794726993, rs794727666, rs863225001, rs779739455, rs886042106, rs886042840, rs763936813, rs886044406, rs1060502639, rs1064796764, rs753662330, rs398123909, rs182575709, rs1556880354, rs1557380616, rs1557047827, rs796523999, rs886043375, rs1556875224, rs1556852444, rs1569558953, rs1569560475, rs1569563740, rs1602169535, rs1601809011, rs1603632322, rs1603636537, rs376745644	21641384
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	25199511
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	rs121908602, rs121908604, rs864309713, rs775394591	30418988
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	11500196, 16934270
Duchenne and becker muscular dystrophy	Duchenne and Becker Muscular Dystrophy	rs794727661, rs1556930579	21641384
Duchenne muscular dystrophy	Muscular Dystrophy, Duchenne	rs128625226, rs128625227, rs128625228, rs128625229, rs2147483647, rs104894787, rs128625230, rs128626234, rs201366610, rs267606770, rs128626235, rs128626231, rs146071084, rs128626232, rs104894788, rs128626233, rs128626238, rs128626239, rs128626240, rs128626241, rs1556834513, rs128626242, rs128626243, rs128626244, rs128626245, rs128626246, rs128626247, rs128626248, rs128626249, rs128626250, rs128626251, rs128626252, rs128626253, rs128626254, rs104894790, rs104894797, rs5030730, rs1569528138, rs587776747, rs128627256, rs128627257, rs398122853, rs398123827, rs398123828, rs398123832, rs398123833, rs398123834, rs398123835, rs398123838, rs398123839, rs398123846, rs398123852, rs398123853, rs72468700, rs398123856, rs398123862, rs398123863, rs398123865, rs398123866, rs398123870, rs398123872, rs398123873, rs398123881, rs398123882, rs398123883, rs398123884, rs398123885, rs398123887, rs398123888, rs398123889, rs398123892, rs398123893, rs398123901, rs398123903, rs398123905, rs398123909, rs398123912, rs398123915, rs398123919, rs398123920, rs398123923, rs398123929, rs398123934, rs398123935, rs398123937, rs398123938, rs398123942, rs398123948, rs398123950, rs398123952, rs398123953, rs398123957, rs398123960, rs398123962, rs398123963, rs398123970, rs398123971, rs398123973, rs398123977, rs398123979, rs398123980, rs398123981, rs398123990, rs1064325, rs398123991, rs398123997, rs398123999, rs398124003, rs398124007, rs398124008, rs398124012, rs398124033, rs398124034, rs398124036, rs398124038, rs398124039, rs398124040, rs398124042, rs398124044, rs398124050, rs398124051, rs398124055, rs398124058, rs398124060, rs398124062, rs398124068, rs398124070, rs398124072, rs398124073, rs398124074, rs398124075, rs398124078, rs398124091, rs398124092, rs398124094, rs398124096, rs398124099, rs398124104, rs398124105, rs373286166, rs727503850, rs727503802, rs727503864, rs794726993, rs794727030, rs794727123, rs794727357, rs794727359, rs794727422, rs794727463, rs794727499, rs794727661, rs794727666, rs797044764, rs201361100, rs796065333, rs794727862, rs794727890, rs797045526, rs146880270, rs863224977, rs863224976, rs863224975, rs863225018, rs863225017, rs863225015, rs863225014, rs863225013, rs863225012, rs863225011, rs863225010, rs863225009, rs762394978, rs863225008, rs863225007, rs863225006, rs863225005, rs863225004, rs863225003, rs863225002, rs777864641, rs863225001, rs863225000, rs863224999, rs863224998, rs863224997, rs863224994, rs863224993, rs863224992, rs756949497, rs863224988, rs863224987, rs863224986, rs762860653, rs863224985, rs863224984, rs863224983, rs863224982, rs863224981, rs863224980, rs863224979, rs863224978, rs863224996, rs863224995, rs863224991, rs863224990, rs863224989, rs878854366, rs779739455, rs878854621, rs770845480, rs762250680, rs878854619, rs878854618, rs886039681, rs886039532, rs886039478, rs886039535, rs886039536, rs886039785, rs886041344, rs886042106, rs886042154, rs886042495, rs886042499, rs886042604, rs886042747, rs886042840, rs886042875, rs398124032, rs886042983, rs886043041, rs886043084, rs763936813, rs886043251, rs886043375, rs886043496, rs886043640, rs886043676, rs886043699, rs886043822, rs886043909, rs886043989, rs748769566, rs886044324, rs886044402, rs886044455, rs886044490, rs886044502, rs886044582, rs1057518207, rs1057518962, rs1057518692, rs1057520764, rs1556641290, rs1060502653, rs1064792968, rs1060502624, rs1060502621, rs765445866, rs1060502645, rs1064792967, rs1060502659, rs1060502620, rs1060502643, rs1060502641, rs1060502639, rs1060502636, rs1060502661, rs1060502635, rs1060502629, rs1060502644, rs72470513, rs1557079469, rs1060502626, rs1060502625, rs1060502630, rs1057524037, rs1060502633, rs1060502656, rs1060502648, rs1060502619, rs1060502646, rs1060502623, rs1060502632, rs1060502640, rs1557380496, rs1060502647, rs1060502637, rs1060502634, rs1060502615, rs1060502627, rs1557084128, rs1060502652, rs1064794569, rs1064793479, rs1064793986, rs1064793964, rs1556665303, rs753662330, rs1556790316, rs1556656184, rs1556764743, rs1556764753, rs1556806356, rs773643220, rs1556875180, rs1340365803, rs1556656851, rs1557316295, rs1556046080, rs1556256329, rs1556656487, rs1556962223, rs1556962571, rs1557011973, rs1557291170, rs1556930769, rs104894789, rs1556665052, rs1556917057, rs1557305645, rs182575709, rs1556656818, rs1557218076, rs1239018406, rs1557084067, rs1557300135, rs1556035795, rs1556037455, rs1556853039, rs1556880354, rs1557380616, rs1557047827, rs1557396600, rs1557374667, rs796523999, rs1557320151, rs1057517960, rs1557304860, rs770183212, rs1557218093, rs1557038061, rs1557320194, rs1233380601, rs1557294228, rs1557011929, rs1557322838, rs1057518284, rs1557291242, rs1557292678, rs1557322834, rs1557058415, rs1556780579, rs1556930579, rs1557369493, rs1556764934, rs1556962271, rs1557315928, rs1555998436, rs1556764922, rs1556656847, rs1557218131, rs1557369413, rs1557369991, rs1557374482, rs1055371114, rs1556040444, rs1557291229, rs1010666282, rs1556028034, rs1556929259, rs1556930839, rs1557303544, rs1557380685, rs1556802319, rs1556809704, rs1557058308, rs1557058350, rs1385794215, rs1556035817, rs1556503937, rs1556656456, rs1556764880, rs1556789913, rs1557322201, rs1557359217, rs1557362198, rs1556853298, rs1556875224, rs1556876346, rs1556852444, rs1569460607, rs1569530432, rs1569451994, rs1569452000, rs1569559106, rs144732570, rs1569273905, rs1569526122, rs1569562941, rs1569230406, rs1569559822, rs1569526579, rs1569528101, rs1569533965, rs1569546174, rs1569559110, rs1569559849, rs1569562936, rs1569562952, rs1057522454, rs149106712, rs1569469298, rs1569401103, rs1209389771, rs1569563678, rs1569560739, rs868688877, rs1569558953, rs1569230215, rs1569563751, rs1569565192, rs1569559204, rs1569186252, rs1569558906, rs1569533147, rs1569559097, rs1569564281, rs1569562466, rs1569169560, rs1429329309, rs1569460722, rs1569556943, rs1569420861, rs1569213903, rs374744331, rs1569463953, rs1569230293, rs1295394996, rs1602451773, rs1602145926, rs1602416457, rs886043597, rs1602728959, rs72466562, rs1602938385, rs1603222095, rs1603280511, rs1603452196, rs142500746, rs1254776844, rs1603513684, rs1603513697, rs1603618489, rs1603632245, rs1603632312, rs1603634298, rs1603634608, rs1603634744, rs1602169535, rs1602460062, rs1603432076, rs1603441550, rs1602766725, rs1603419076, rs1603447081, rs1603631757, rs1601809011, rs1602727611, rs1603222556, rs1602146767, rs1602337330, rs895755247, rs1602369798, rs1602409174, rs1602417503, rs1181271457, rs1602454605, rs1602454639, rs1602454747, rs1602455302, rs1602455747, rs1602456486, rs1602669026, rs1602695597, rs1602696519, rs1602730254, rs1602947628, rs1603253563, rs1601864055, rs1602056443, rs1602937974, rs1556656077, rs1603221854, rs1603222424, rs1603222574, rs1603222897, rs1603222922, rs1603223025, rs794727770, rs1603226023, rs1603264641, rs1603264659, rs1603264705, rs1603264731, rs1603280686, rs1603280745, rs1603280796, rs1603430178, rs1603430181, rs1603445277, rs1603445278, rs1603445283, rs1603445332, rs1603445344, rs1603452207, rs1603513680, rs1603513803, rs1603513817, rs1603513828, rs1603514271, rs1603514272, rs201818335, rs1603615883, rs1603628479, rs1603628482, rs1603628483, rs1603628485, rs1603628487, rs1603629988, rs1603630431, rs1603631225, rs1603631240, rs1603631241, rs1603631244, rs1603631367, rs1603631368, rs373428963, rs1603631705, rs1603631744, rs1603631752, rs1603631756, rs1603632117, rs1603632119, rs771425504, rs1216000876, rs1603632248, rs1603632309, rs1603632311, rs1603632314, rs1603632316, rs772220893, rs1603632322, rs1603632324, rs1603632326, rs1603633486, rs1603633541, rs1603633545, rs1339088514, rs398123943, rs1603633864, rs1603633868, rs1603634079, rs1569563740, rs1603634105, rs1603634199, rs1603634203, rs1603634206, rs1603634207, rs1603634299, rs1603634603, rs1603634604, rs1603634607, rs1603634609, rs747937552, rs1603634742, rs1603634743, rs1603634745, rs1603634746, rs1603634747, rs1603634748, rs1603635326, rs1603635331, rs1603635949, rs1603635950, rs1603635953, rs1603636537, rs1603636541, rs1601808288, rs1601808296, rs1601808326, rs1601808608, rs1601810667, rs1602467530, rs1602467590, rs1602467787, rs1602468968, rs1602469251, rs1602469384, rs1603137168, rs1603149954, rs1603150335, rs1603150993, rs374222301, rs1603151699, rs1603432059, rs794727863, rs1603437254, rs1603437272, rs1603441629, rs1603447057, rs1603447072, rs1602765633, rs1602766499, rs1602766531, rs1602766655, rs1403865104, rs1603419074, rs768892830, rs1603631365, rs1602765856, rs1602338283, rs1602360475, rs1603631219, rs1603634749, rs1602459252, rs2040217313, rs376745644, rs2040714340, rs2041309291, rs2044445392, rs2067953453, rs2068036881, rs2068038543, rs2078916448, rs2090513299, rs2094827204, rs2094864356, rs2095370524, rs1425702864, rs2097850041, rs2098390819, rs2042979418, rs2046036327, rs2052700227, rs2077781516, rs2080979223, rs2040711393, rs2097447247, rs2098280263, rs2098391032, rs2063781031, rs2080514041, rs2036834025, rs2063903818	21641384
Endometrial carcinoma	Endometrial Carcinoma	rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077, rs587779206, rs63750439, rs63751405, rs63750741, rs63750854, rs63750909, rs587779212, rs63749874, rs267608076, rs587779220, rs63750735, rs267608082, rs587779227, rs267608068, rs63750075, rs587779232, rs267608058, rs63751127, rs63750138, rs267608065, rs63751017, rs587779246, rs63750111, rs63750563, rs267608073, rs63751407, rs63749999, rs267608042, rs63750833, rs587779255, rs587779256, rs267608078, rs267608092, rs587779263, rs267608098, rs587779267, rs63750194, rs63751327, rs63751328, rs587779284, rs63749942, rs63751058, rs267608114, rs267608118, rs63751319, rs267608128, rs1553333594, rs267608126, rs63750767, rs267608120, rs267608121, rs267608122, rs63750342, rs63749873, rs587779318, rs63750019, rs63749980, rs267608048, rs1553412283, rs146816935, rs63750855, rs63751711, rs267607789, rs587779094, rs63750224, rs267607972, rs63750084, rs587779185, rs587778617, rs398123231, rs398123232, rs398123318, rs587780021, rs63750119, rs267608064, rs587781490, rs587781558, rs587781691, rs63749821, rs587782111, rs587782326, rs587782704, rs587779264, rs587779333, rs587782712, rs587783056, rs730881825, rs730881827, rs730881829, rs730881830, rs786202193, rs587782281, rs786202848, rs786201049, rs750528093, rs786202108, rs267608083, rs786201050, rs786203924, rs587781544, rs786201084, rs1553333738, rs863224829, rs863225398, rs863225409, rs863225412, rs864622041, rs869312769, rs869312770, rs63751077, rs876661205, rs876661025, rs63749919, rs876661073, rs876661222, rs267608041, rs878853702, rs751326348, rs866260675, rs886039666, rs886044911, rs1057517552, rs1057517764, rs1057517763, rs121909224, rs1057520605, rs1060502885, rs1060502918, rs1060502932, rs587779215, rs1060502937, rs1060502886, rs1060502875, rs1060502881, rs267607939, rs1023534466, rs1064793600, rs1064795256, rs1064795591, rs1064794055, rs1064794164, rs1553414010, rs1064793671, rs1064794302, rs1064793489, rs1064794384, rs1064793781, rs1553333500, rs760190301, rs1114167719, rs1114167776, rs1114167704, rs1114167748, rs1114167731, rs753796271, rs267608055, rs1114167746, rs1114167715, rs587782706, rs1114167750, rs1114167765, rs1114167747, rs786204048, rs1114167707, rs1114167767, rs1114167717, rs1114167783, rs1553412966, rs1553333598, rs587779297, rs1554294505, rs988423880, rs1554306353, rs1553408136, rs1553333321, rs1553408388, rs63749973, rs1553412064, rs1553412120, rs1553826166, rs1553413784, rs1553331242, rs1553414519, rs1564568660, rs1558392033, rs878853704, rs765763906, rs1558663559, rs1572720704, rs63750985, rs1572727440, rs587779253, rs1580538168, rs149350323, rs374133543, rs771721952, rs201033017, rs763478027, rs1475633334, rs1580553624, rs1580553669, rs578113271, rs757194485, rs539295465, rs778610412, rs758191157, rs1580597397, rs1580033751, rs751236312, rs376667075, rs1561486630, rs1561486632, rs777054839, rs1204002507, rs766672143, rs1580091499, rs1386063673, rs1450314617, rs1580027713, rs367544716, rs1488467945, rs1580053768, rs1580553607, rs1572720794, rs1572722039, rs1572723786, rs1572725235, rs1572728112, rs1175196087, rs1572741984, rs1580540688, rs1259647122, rs1580546793, rs1234762807, rs1580556516, rs1669245178, rs1669365820, rs756190979, rs371356175, rs766997264, rs1743353294, rs1379605717, rs770330684, rs1462955256, rs1744356274, rs1480047980, rs1744149615	17380299
Glomerulonephritis	Glomerulonephritis	rs778043831	10385480
Hydrocephalus	Hydrocephalus	rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546
Hyperinsulinism	Hyperinsulinism	rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209, rs761749884, rs797045624, rs863225280, rs139964066, rs1057516281, rs1057516317, rs576684889, rs201682634, rs1350717554, rs768951263, rs1260178539, rs200670692, rs72559734, rs1400535021, rs372307320, rs1554923999, rs751279984, rs1008906426, rs367850779, rs1382448285, rs1564977373, rs750586210, rs1599937180	29035695
Hyperoxaluria	Hyperoxaluria, Oxalosis	rs397509360, rs138207257, rs2041105506, rs267606763, rs267606764, rs80356708, rs119490108, rs121908520, rs121908521, rs121908522, rs121908523, rs121908524, rs121908525, rs121908526, rs121908527, rs121908528, rs121908530, rs121908529, rs180177201, rs180177238, rs180177321, rs672601351, rs180177322, rs180177157, rs180177168, rs180177195, rs180177197, rs180177207, rs180177227, rs180177239, rs180177253, rs180177259, rs786204545, rs180177267, rs180177301, rs180177156, rs180177307, rs138584408, rs180177194, rs180177213, rs180177191, rs34116584, rs180177262, rs180177268, rs180177278, rs180177162, rs180177166, rs180177170, rs180177171, rs180177172, rs180177173, rs180177177, rs767586362, rs180177181, rs180177182, rs796052058, rs796052069, rs180177183, rs180177184, rs180177185, rs180177186, rs796052059, rs180177187, rs180177189, rs180177193, rs180177198, rs796052060, rs180177199, rs180177200, rs180177202, rs180177203, rs796052061, rs180177208, rs138025751, rs796052067, rs113681235, rs796052070, rs180177210, rs180177211, rs180177214, rs180177215, rs180177217, rs180177219, rs180177220, rs180177221, rs180177222, rs180177223, rs180177224, rs180177225, rs180177231, rs180177232, rs180177233, rs180177234, rs180177235, rs180177236, rs180177237, rs180177240, rs180177241, rs180177243, rs180177244, rs796052062, rs180177245, rs180177246, rs536352238, rs180177247, rs180177248, rs180177250, rs180177251, rs180177252, rs180177254, rs111996685, rs111742810, rs180177256, rs1553648931, rs180177257, rs180177258, rs180177261, rs796052072, rs180177263, rs180177264, rs180177265, rs796052068, rs180177269, rs180177270, rs180177272, rs180177273, rs180177276, rs180177279, rs180177284, rs180177281, rs180177286, rs180177285, rs180177287, rs180177288, rs180177292, rs180177293, rs180177294, rs180177295, rs180177296, rs180177297, rs180177298, rs796052063, rs180177299, rs796052074, rs180177300, rs180177302, rs796052064, rs180177303, rs180177155, rs756437332, rs796052065, rs180177158, rs180177160, rs180177161, rs180177163, rs180177164, rs796052066, rs180177255, rs180177289, rs796052077, rs180177311, rs180177319, rs180177304, rs180177305, rs796052078, rs796052081, rs180177308, rs180177309, rs180177313, rs180177314, rs180177315, rs180177316, rs796052082, rs180177317, rs180177324, rs180177325, rs746419489, rs764396564, rs758304537, rs796052084, rs796052088, rs796052089, rs150702945, rs767405535, rs796052090, rs202047589, rs185803104, rs796052085, rs755562733, rs796052086, rs770050262, rs756489804, rs796052087, rs149150736, rs777046879, rs796052091, rs796052092, rs1057516896, rs751101495, rs1057517398, rs1057517238, rs1057516299, rs1057517333, rs1057517026, rs771019056, rs1057516990, rs1057516292, rs1057516823, rs1057516831, rs1419840309, rs757796926, rs1553648568, rs778567956, rs112673831, rs1553649375, rs1553648488, rs1553648493, rs1553649007, rs1554746094, rs1244822375, rs1554746097, rs1554746565, rs1422977131, rs1331106064, rs1554746793, rs1257080057, rs1554748528, rs1554748598, rs777683624, rs776817346, rs779208888, rs1554747871, rs111256477, rs1554747933, rs1554748534, rs1554748574, rs1425736036, rs1554874130, rs1554874148, rs746776892, rs990830655, rs752277936, rs749315029, rs1564297234, rs1564753668, rs924232072, rs1564300888, rs1564760008, rs774654020, rs1588757756, rs148049120, rs1553648979, rs1822898131	16284884
Hypertension	Hypertensive disease	rs13306026	20667508, 27292124
Metabolic syndrome	Metabolic Syndrome X	rs367643250, rs587777380, rs777736953	16188961, 18486454
Moyamoya disease	Arterial Diseases, Common Carotid	rs121434527, rs121434528, rs387906592, rs397514563, rs797045187, rs1555675538, rs1568149971, rs1599150380, rs2079443410	18022660
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962, rs751524927, rs1575079076, rs1575446356, rs1478603808, rs1578264146, rs1578673280, rs1579484570, rs1579491104, rs1171390403, rs1582867955, rs764264135, rs951047896, rs890521687, rs1581495906, rs1587941402, rs1003155450, rs1588299621, rs1591100766, rs1591693095, rs1029296641, rs1593107841, rs1208575764, rs1593835248, rs1594406727, rs1594966387, rs1595889508, rs1159294530, rs1597073318, rs1135402871, rs1599413207, rs1418268495, rs1212577459, rs1600394490, rs1455074519, rs1603113792, rs1603415028, rs1602247047, rs1603452612	16918137
Neural tube defect	Neural Tube Defects	rs121434297, rs137853061, rs137853062, rs768434408, rs777661576, rs747846362, rs200137991, rs780014899, rs574132670, rs786204013, rs147257424, rs763539350, rs776483190, rs781461462, rs1114167354, rs147277149, rs765586205, rs377443637, rs986604359, rs1293600145, rs114727354, rs768980918, rs140277700, rs139645527, rs750323424, rs368321176, rs1579619636, rs893229476, rs754990692, rs763079713, rs1593037878, rs747100389, rs372056091, rs1593083585, rs778121031, rs748778907, rs776969786, rs1189298981, rs375908206, rs1734858651, rs778738842
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562, rs121913564, rs193922650, rs193922685, rs193922687, rs751160202, rs747681609, rs1553400259, rs13447339, rs370479598, rs1554394014, rs1553174844, rs756232889, rs369841551, rs1557670950, rs1571321748, rs148538980, rs1572820988, rs1591461970, rs1419374563, rs745921568, rs144159890, rs1570714352, rs779783209, rs1573250294, rs1573254045, rs1580744791, rs1580746829	29035695
Pulmonary fibrosis	Pulmonary Fibrosis	rs121918666, rs199422300, rs121917834, rs199422294, rs201159197, rs199422297, rs199422305, rs751381953, rs876661305, rs878853260, rs1555811762, rs1060502990, rs1555903332, rs1554038539, rs1554042899, rs938938578	17720292, 26163174, 16324872
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	18486454
Tumoral calcinosis	Tumoral calcinosis	rs104894343, rs104894344, rs745655924, rs137853086, rs375879489, rs761396172, rs137853087, rs137853091, rs137853088, rs137853089, rs137853090, rs766750282, rs760830864, rs786205250, rs267606841, rs1555096583, rs1220533001, rs762936774, rs775341386	21335463, 21193197

Unknown
Disease term	Disease name	Evidence	References	Source
Asthma	Asthma		19373627	ClinVar
Atherosclerosis	Atherosclerosis		12928151, 12677255, 20720404	ClinVar
Congestive heart failure	Congestive heart failure		29959987	ClinVar
Crohn disease	Crohn Disease, Regional enteritis		21829567	ClinVar
Heart failure	Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided		29959987	ClinVar
Mental depression	Unipolar Depression, Major Depressive Disorder		15296827	ClinVar
Myocardial infarction	Myocardial Failure		29959987	ClinVar
Neural Tube Defect	neural tube defects, susceptibility to			GenCC
Crohn Disease	Crohn Disease			GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Ulcerative colitis	Ulcerative colitis			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Abdominal Pain	Associate	30918467
Acidosis	Associate	38069241
Acquired Immunodeficiency Syndrome	Associate	11931709
Acquired Immunodeficiency Syndrome	Stimulate	26475133
Acute Coronary Syndrome	Stimulate	20061546
Acute Coronary Syndrome	Associate	35563407
Acute Febrile Encephalopathy	Stimulate	15608388
Acute Febrile Encephalopathy	Associate	22012040
Acute Kidney Injury	Stimulate	18784644, 23511138, 33348065
Acute Kidney Injury	Associate	28640195, 33974569
Acute On Chronic Liver Failure	Associate	34774066, 35502507
Adenocarcinoma	Associate	33974569, 8701989
Adenocarcinoma of Lung	Associate	29722145, 36625357, 38204755
Adjustment Disorders	Associate	37500699
Aggressive Periodontitis	Associate	21264360, 28427824
AIDS Associated Nephropathy	Associate	18480829, 23198981, 25716997
AIDS Dementia Complex	Associate	12374865, 18508485, 22347417
AIDS Dementia Complex	Stimulate	9501225
Air crescent sign	Associate	10469367
Albinism with hemorrhagic diathesis and pigmented reticuloendothelial cells	Stimulate	19729668
Alcoholism	Associate	18190912
Alcoholism	Stimulate	18190912
Allan Herndon Dudley syndrome	Stimulate	24768357
Allergic Fungal Sinusitis	Associate	33629532, 36780897
Alopecia Areata	Associate	16479072, 34752683
Alzheimer Disease	Stimulate	17284607, 18637012, 21755121, 22543850, 23380586, 40348203
Alzheimer Disease	Associate	22272623, 24359497, 29352259, 30092003, 30336198, 32634865, 34624603, 37848007, 38167125
Amyotrophic Lateral Sclerosis	Stimulate	21906274, 28798369, 29592817
Amyotrophic Lateral Sclerosis	Associate	22685564, 30572951, 32515902
Anemia	Associate	21442636, 21859849
Anemia Sickle Cell	Associate	33776989
Aneurysm	Associate	23887838
Angina Pectoris	Associate	19639050
Angina Stable	Associate	22420243
Angina Unstable	Inhibit	12871422
Angina Unstable	Associate	22664781
Angina Unstable	Stimulate	25424368
Antiphospholipid Syndrome	Associate	11937582, 25785264
Aortic Aneurysm Abdominal	Associate	16308497, 17321344, 19008128, 25033895, 8494046
Aortic Aneurysm Familial Abdominal 1	Stimulate	19008128, 26925780
Appendicitis	Associate	30918467
Arthritis	Stimulate	22035391
Arthritis	Associate	22687048, 40534874
Arthritis Infectious	Associate	32154187
Arthritis Psoriatic	Associate	10086850, 12368213, 30181004, 31864394
Arthritis Psoriatic	Stimulate	23480385
Arthritis Rheumatoid	Stimulate	10494903, 16464743, 16901957, 22131127, 7521808
Arthritis Rheumatoid	Associate	11178128, 11352233, 12588667, 15077296, 1522232, 15248214, 16740681, 17530707, 18205922, 18576354, 19404929, 19565503, 19625220, 21834066, 23784528, 26223686, 26514518, 28619088, 28708839, 30079994, 30897288, 31729947, 32365786, 32508836, 33508012, 33879239, 33977746, 34195267, 36439145, 38043198, 38459704, 7545093
Arthritis Rheumatoid	Inhibit	24023637, 25918734, 32497778
Asthma	Associate	16792687, 18492738, 23454776, 24736642, 24931417, 26207385, 31391224, 31676759, 33626956, 34525985, 37455894
Asthma	Stimulate	21999750, 24641287
Asthma	Inhibit	40696647
Astrocytoma	Associate	1937574
Atelosteogenesis type 2	Associate	34425224
Atherosclerosis	Associate	10413089, 10858246, 11104691, 11403209, 11415454, 14620921, 15056843, 15226634, 15908470, 16474202, 17295000, 17499741, 17587761, 18164016, 18670098, 19148342, 19152916, 19293636, 19332545, 19561397, 19625220, 19958400, 20069129, 20818133, 21859809, 22541858, 23166687, 23402987, 24020822, 24098801, 25786118, 26867220, 27458015, 29098933, 31350345, 35052452, 35860283, 37652021, 38256102, 7614716, 7651403
Atrial Fibrillation	Associate	14998623, 23397981
Atrophy	Stimulate	34721402
Autism Spectrum Disorder	Inhibit	30430410
Autism Spectrum Disorder	Stimulate	34128902
Autistic Disorder	Stimulate	20102735
Autoimmune Diseases	Associate	19668598, 33386704, 34752683
Basal Ganglia Diseases	Associate	36860843
Behcet Syndrome	Associate	15115316, 24984193, 34624603
Behcet Syndrome	Stimulate	15248229
Biliary Atresia	Associate	35774294
Bipolar Disorder	Associate	38484669
Blast Injuries	Associate	31621494
Blast Injuries	Stimulate	36508265
Blister	Associate	26293297
Blood Coagulation Disorders	Associate	26667361
Bone Diseases	Stimulate	12823344
Bone Diseases	Associate	15287939, 22131127
Bone Resorption	Associate	16280328
Brachydactyly Type D	Associate	28504607
Brain Abscess	Associate	34624603
Brain Diseases	Associate	35443752
Brain Injuries Traumatic	Stimulate	22543850
Brain Ischemia	Associate	19755790
Breast Neoplasms	Associate	15192307, 16003740, 16849564, 17261184, 21486440, 23078970, 23543442, 23991131, 25928089, 26314842, 26514518, 26996066, 27125354, 28420351, 29685151, 30808421, 31659097, 31710162, 32649310, 32986377, 33146700, 34239022, 34775491, 34848446, 36038549, 37341066, 40550227
Breast Neoplasms	Stimulate	36674955
Bronchial Hyperreactivity	Associate	16792687
Bronchiolitis Obliterans Syndrome	Associate	21276737
Bronchiolitis Obliterans Syndrome	Stimulate	22006860
Bronchopulmonary Dysplasia	Stimulate	30459472
Bronchopulmonary Dysplasia	Associate	37090732
Buschke Ollendorff syndrome	Stimulate	18513272
Cachexia	Associate	33047901
Carcinogenesis	Associate	26648448, 33682749, 36674955
Carcinoma Adenosquamous	Associate	27145753
Carcinoma Basal Cell	Associate	31031757
Carcinoma Ductal	Associate	25928089, 27903846
Carcinoma Hepatocellular	Associate	12402381, 23684136, 23874805, 29115520, 33891564, 35955552, 36828281, 37904170, 37976890, 39756577, 40148834
Carcinoma Hepatocellular	Stimulate	29556041, 37096803, 38015590
Carcinoma Intraductal Noninfiltrating	Associate	21486440
Carcinoma Non Small Cell Lung	Associate	10823415, 20449809, 23090289, 25318604, 27145753, 33562773, 35443752, 35928634
Carcinoma Non Small Cell Lung	Stimulate	17433654
Carcinoma Ovarian Epithelial	Associate	39773697
Carcinoma Pancreatic Ductal	Associate	20579680
Carcinoma Pancreatic Ductal	Stimulate	22190968, 25827621
Carcinoma Papillary	Associate	25234717
Carcinoma Renal Cell	Associate	22699780, 23657965, 27409666, 29905412
Carcinoma Renal Cell	Stimulate	24768357
Carcinoma Squamous Cell	Associate	33723932, 34177903, 8909236
Cardiomyopathies	Associate	33988313
Cardiomyopathy Dilated	Associate	17467829, 19632522
Cardiovascular Diseases	Associate	25786118, 26514518, 29098933, 32806763, 37148770
Carotid Artery Diseases	Associate	14620921, 19506371, 36959587
Carotid Stenosis	Associate	16308497, 18060801, 19506371, 25441669
Cataract	Stimulate	32855850
Cataract	Associate	37694725, 39959181
Celiac Disease	Associate	31717494
Central Nervous System Viral Diseases	Inhibit	33674737
Cerebral Infarction	Associate	22942727
Chagas Cardiomyopathy	Associate	34592495
Chemical and Drug Induced Liver Injury	Associate	21527401, 9466568
Chills	Associate	14984503
Cholangitis Sclerosing	Associate	24390753, 34519176
Chorioamnionitis	Associate	27318328
Chorioamnionitis	Stimulate	34359894
Choristoma	Associate	18314120
Choroidal Effusions	Associate	33977746
Choroideremia	Inhibit	20027300
Chronic Kidney Disease Mineral and Bone Disorder	Associate	28784837
Chronic Pain	Associate	39231552
Chronic Periodontitis	Associate	21198766
Chronic Urticaria	Associate	22132892, 37646031
Cleft Lip	Associate	19929093
Cleft Palate	Associate	30688042
Cognition Disorders	Associate	26284520, 29352259, 32634865
Cognition Disorders	Stimulate	33075233
Cognitive Dysfunction	Stimulate	22543850
Cognitive Dysfunction	Associate	37686198
Coinfection	Stimulate	30679661
Cold Injury	Stimulate	30385348
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Stimulate	25948880
Colitis Ulcerative	Stimulate	10433925, 34298022
Colitis Ulcerative	Associate	21129005, 22467146, 31584460, 33409535, 33879239
Colonic Diseases	Associate	16085694
Colorectal Neoplasms	Associate	16101183, 26515597, 28347237, 28629469, 29154245, 30419802, 31545552, 31781676, 34256095, 34639088, 36693067, 38459704
Colorectal Neoplasms	Stimulate	30970512
Communicable Diseases	Associate	11931709
Complex Regional Pain Syndromes	Stimulate	22074333
Conjunctivitis Allergic	Associate	11090473
Conversion Disorder	Associate	24737013
Corneal Endothelial Cell Loss	Associate	31847785
Coronary Artery Disease	Associate	19148342, 19506371, 22780915, 23930970, 25424368, 25786118, 26867220, 27537567, 29067980, 30961613, 33740174, 38459704
Coronary Artery Disease	Stimulate	27458015, 33504180
Coronary Disease	Associate	36101804
Coronary Restenosis	Stimulate	11999660
Coronavirus Infections	Stimulate	28103598
Coronavirus Infections	Associate	35726234
COVID 19	Associate	25818534, 32228226, 32497778, 32816392, 32920092, 32943497, 33052054, 33078545, 33138195, 33187979, 33399033, 33879239, 33947753, 34174375, 34177897, 34214498, 34450402, 34539631, 34566957, 34987646, 35037831, 35145507, 35319225, 35350779, 35726234, 35753602, 35855804, 35982898, 36012423, 36232655, 36901868, 37148770
COVID 19	Stimulate	32866033, 33413449, 34543980, 36148228, 38290406
Crohn Disease	Associate	20570966, 22467146, 33879239
Cystic Fibrosis	Stimulate	19000946, 20438838, 34721395
Cystic Fibrosis	Associate	26485688
Cystitis	Associate	30905425
Cytokine Release Syndrome	Stimulate	36797068
Cytomegalovirus Infections	Stimulate	18513272, 32749463
Cytomegalovirus Infections	Associate	28501927, 36232655
Death	Stimulate	20404020
Death	Associate	22012040, 33187979
Dementia	Associate	12374865, 21760952, 9501225
Demyelinating Diseases	Associate	27733565, 9916917
Dentin dysplasia sclerotic bones	Associate	17515952
Depressive Disorder Major	Stimulate	24424390
Depressive Disorder Major	Associate	30870525
Dermatitis Atopic	Associate	15370700, 22272250, 32035984, 34070943
Dermatitis Atopic 3	Associate	23454776
Dermatitis Contact	Associate	37187734
Diabetes Complications	Associate	21532752
Diabetes Gestational	Stimulate	31880859, 35390031
Diabetes Gestational	Associate	35813663
Diabetes Mellitus	Associate	18385799, 18670098, 18803760, 20526368, 21203348, 22385239, 23549806, 24382482, 29513874, 34517005, 40065310
Diabetes Mellitus	Stimulate	19755790, 22776897, 24521217, 24936866, 25503660, 27123454, 28454543, 34944529
Diabetes Mellitus Type 1	Associate	16045741, 18762729, 21532752, 23624551, 27406064
Diabetes Mellitus Type 1	Inhibit	16566827
Diabetes Mellitus Type 1	Stimulate	28380011
Diabetes Mellitus Type 2	Associate	17372317, 17982227, 18762729, 23549806, 23930970, 24936866, 25154422, 29641741, 30139387, 32816392, 35960063, 36674502, 39217825
Diabetes Mellitus Type 2	Stimulate	24429578, 24495560, 27904654
Diabetes Mellitus Type 2	Inhibit	34944529
Diabetic Angiopathies	Associate	23549806, 25154422
Diabetic Foot	Associate	29901584, 29995756
Diabetic Foot	Stimulate	29901584
Diabetic Nephropathies	Associate	10916091, 11012884, 12803507, 17408061, 17728497, 17982227, 19357773, 22629296, 33122288, 34087849, 35363774, 35843953, 35991124, 38013385
Diabetic Nephropathies	Stimulate	24786705, 29999450
Diabetic Retinopathy	Associate	23549806, 33156339
Disease	Inhibit	31339548
Disease	Associate	9010269, 9528906
Disorders of Sex Development	Associate	33422029
Dissection Thoracic Aorta	Associate	38420822
Down Syndrome	Associate	29093484
Drug Hypersensitivity	Associate	19657353
Drug Hypersensitivity	Stimulate	24641287
Drug Related Side Effects and Adverse Reactions	Associate	19866475, 29682101
Drug Related Side Effects and Adverse Reactions	Inhibit	29989092
Drug Resistant Epilepsy	Stimulate	18402383
Drug Resistant Epilepsy	Associate	23996681
Dry Eye Syndromes	Associate	27486749
Dry Eye Syndromes	Stimulate	29673232
Duane Retraction Syndrome	Stimulate	21203348
Ectodermal Dysplasia	Associate	16479072
Edema	Associate	34439789
Embolism Air	Associate	24945146
Embolism Fat	Stimulate	18388185
Emphysema	Stimulate	29872287
Encephalitis	Associate	10068657
Encephalitis	Stimulate	24413261
Encephalitis Japanese	Associate	29057937
Endocrine System Diseases	Stimulate	31710162
Endometrial Neoplasms	Associate	36231119
Endometriosis	Associate	11056242, 12372466, 17678915, 18314120, 24133578, 39458478, 9176445
Endometriosis	Stimulate	22265030, 34360900, 34930225, 39244839, 9422530
Endophthalmitis	Stimulate	30296277
Endotoxemia	Stimulate	19794059
Enterocolitis Necrotizing	Stimulate	24732104
Eosinophilic Esophagitis	Associate	30455683
Epilepsy Post Traumatic	Inhibit	30455683
Erdheim Chester Disease	Associate	17133532
Erythema Ab Igne	Stimulate	11937582
Esophageal Neoplasms	Associate	24284961
Esophageal Squamous Cell Carcinoma	Associate	24284961, 26942702, 30683902, 37248653
Esophagitis	Associate	22734465
Essential Hypertension	Stimulate	16382212
Essential Hypertension	Associate	22697070
Exanthema	Associate	30540703
Exfoliation Syndrome	Associate	33914756
Fabry Disease	Associate	35417091, 40420032
Fatigue	Stimulate	37881427
Fetal Growth Retardation	Inhibit	18274642
Fibromyalgia	Associate	18535166
Fibromyalgia	Stimulate	23762283
Fibrosis	Associate	10444270, 12803507, 20484496, 21527401, 26576741, 27569940, 28231837, 28273242, 31822289, 32317146, 32406487, 33465050, 34774066, 35328046
Fibrosis	Stimulate	29151327, 37606981, 38015590, 9466568
Focal cortical dysplasia of Taylor	Associate	20345941
Fractures Spontaneous	Associate	25206284
Fragile X Syndrome	Associate	20102735
Frailty	Associate	27102154
Frontotemporal Lobar Degeneration	Associate	31559531
Fuchs' Endothelial Dystrophy	Associate	31847785
Gardner Syndrome	Stimulate	33682749
Gastroesophageal Reflux	Stimulate	18506929
Gastrointestinal Hemorrhage	Inhibit	30852582
Gastrointestinal Stromal Tumors	Associate	25120735
GATA2 Deficiency	Associate	19965620
Gaucher Disease	Stimulate	19587377
Gerodermia osteodysplastica	Associate	32735324
Glaucoma	Stimulate	16943231
Glaucoma Angle Closure	Associate	26748993, 33438359
Glaucoma Angle Closure	Stimulate	36254076
Glaucoma Open Angle	Stimulate	34294770
Glaucoma Open Angle	Associate	40353220
Glioblastoma	Associate	17522861, 26152356, 30048972, 31467175, 33075233, 33964937, 34987659, 35562953, 35726234, 37662685, 38057698, 9613677
Glioblastoma	Inhibit	22554389
Glioma	Associate	17522861, 2211704
Glioma	Stimulate	26749234
Glomerulonephritis	Associate	10469367, 16436653, 17428349, 24284376
Glomerulonephritis IGA	Associate	27788494, 32388684, 37862725, 37908345
Glomerulonephritis IGA	Stimulate	28273242, 39516745
Glomerulonephritis Membranous	Stimulate	10620196
Glomerulonephritis Membranous	Associate	33754492
Glomerulosclerosis Focal Segmental	Associate	26335292
Glossitis Benign Migratory	Associate	21641395
Glucagonoma	Stimulate	37872588
Glucosephosphate Dehydrogenase Deficiency	Associate	31350345, 32630408
Glucosephosphate Dehydrogenase Deficiency	Stimulate	33050491
Glutamate Monosodium Sensitivity	Associate	23704830
Graft vs Host Disease	Associate	35486633
Granuloma	Associate	21556333, 25566510, 9528906
Granulomatosis with Polyangiitis	Stimulate	15807865
Graves Ophthalmopathy	Associate	19117935, 22736938, 25159204, 32663289
Graves Ophthalmopathy	Stimulate	33498689
Haemophilus Infections	Stimulate	11349030
HAIR AN syndrome	Stimulate	18825363
Hand Arm Vibration Syndrome	Stimulate	38302542
Hashimoto Disease	Associate	27245471
Hashimoto Disease	Stimulate	34925365
Headache	Associate	11909910
Hearing Loss	Associate	28501927
Hearing Loss Sensorineural	Associate	28501927
Heart Diseases	Associate	17467829, 31077149
Heart Failure	Associate	21900689, 22615818, 34868339
Hemangioma capillary infantile	Associate	20872175, 24599340
Hemihyperplasia Isolated	Stimulate	27910891
Hepatitis Alcoholic	Stimulate	10446112, 22861370
Hepatitis Alcoholic	Associate	22861370
Hepatitis B	Associate	24975639, 26919045
Hepatitis C	Associate	25206284
Hepatitis C	Stimulate	30679661
Hepatitis C Chronic	Associate	15770052
Hepatitis Chronic	Stimulate	8408620
Hepatitis Chronic	Associate	9466568
Hepatitis E	Associate	35328046
Hereditary Breast and Ovarian Cancer Syndrome	Associate	10193522, 15192307
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	38615592
Hereditary leiomyomatosis and renal cell cancer	Associate	9627299
Hidradenitis Suppurativa	Stimulate	36172698
HIV Infections	Associate	10497106, 12374865, 12805068, 16436595, 16916890, 23916293, 24737013, 25821806, 26244388, 33166788
HIV Infections	Stimulate	11878903, 20683959, 26494772, 27065342
Hodgkin Disease	Associate	10193522
Hot Flashes	Associate	23529020
HTLV I Infections	Associate	18784079, 26494772
Huntington Disease	Stimulate	22289889
Hydronephrosis	Stimulate	22744767
Hyper IgM Immunodeficiency Syndrome	Stimulate	16740681, 18729779
Hyperaldosteronism	Associate	39252231
Hyperglycemia	Stimulate	23549806, 25894202
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	17728497, 30114628
Hyperoxia	Stimulate	37884440
Hyperplasia	Associate	32006659
Hypertension	Stimulate	16382212, 22697070, 39595551
Hypertension	Associate	19639050
Hypertrophy	Associate	34876548
Hypomagnesemia 5 Renal with Ocular Involvement	Stimulate	40420032
Hypoxia	Stimulate	12020348, 25411969, 26045772, 30402462
Hypoxia	Associate	33737938
Hypoxia	Inhibit	37735391
Hypoxia Brain	Stimulate	37246768
Idiopathic Pulmonary Fibrosis	Associate	10515417, 15879152, 1608944, 30091381, 30619270, 32317146, 33746960, 33755690, 36601116
Idiopathic Pulmonary Fibrosis	Stimulate	15802346
Idiopathic subglottic tracheal stenosis	Associate	32369195
IgA Vasculitis	Associate	12588667, 15608388, 16464743, 25839768, 28273242, 28691415
Immune Reconstitution Inflammatory Syndrome	Stimulate	23908492
Immune Reconstitution Inflammatory Syndrome	Associate	34390048
Immune System Diseases	Associate	38057698, 39252231
Infections	Inhibit	10497106
Infections	Stimulate	10768935, 10900340, 33737658, 36482106, 40353220, 9573240
Infections	Associate	16436595, 18784079, 18940815, 20038977, 21641395, 28900138, 33072075, 33956935, 36148228, 37881339, 39578766
Inflammation	Associate	10403930, 10916091, 11090473, 11133741, 11264152, 11967286, 12016129, 12134029, 12183528, 12413001, 12803507, 12928151, 12952251, 15142882, 15191888, 15325639, 15502879, 15701693, 15793118, 16059715, 16213701, 16410530, 16479072, 16740681, 16809218, 16867220, 16916890, 17008880, 17138827, 17408061, 17610002, 17634954, 18178718, 18266131, 18334611, 18388185, 18392037, 18430236, 18480829, 18508485, 18637012, 18670098, 18710415, 18762729, 18804210, 18842989, 18937353, 19178793, 1937574, 19383369, 19403722, 19632522, 19725874, 19759245, 19794059, 19818091, 19843090, 19912235, 19915063, 20031590, 20097750, 20103664, 20307321, 20438838, 20488324, 20497022, 20604932, 20824100, 20846165, 20943792, 21097527, 2113354, 21167486, 21283672, 21486440, 21508136, 21611183, 21744278, 21760952, 22013132, 22228203, 22246057, 22272623, 22366233, 22467146, 22552879, 22688341, 23106848, 23221346, 23283995, 23397981, 23407402, 23428978, 23480385, 23552014, 23554896, 23601964, 23613363, 23657965, 23721325, 23735716, 23762283, 23824412, 23897225, 24098801, 24413261, 24428816, 24586454, 24626803, 24752613, 24945146, 24989171, 25092091, 25492529, 25541965, 25890304, 25902044, 25928089, 25963228, 25967876, 26053616, 26138903, 26330750, 26514518, 26556395, 26556871, 26626217, 26752743, 26871994, 26959822, 26993768, 26997568, 27100479, 27123454, 27357630, 27403035, 27409666, 27416040, 27537567, 27591243, 27788494, 27910891, 27922090, 27941938, 28151579, 28159925, 28250190, 28278187, 28420166, 28427824, 28432984, 28560408, 28765968, 28775073, 28798369, 28832545, 28851983, 28892653, 29039485, 29048610, 29257294, 29259394, 29378051, 29504848, 29664944, 29682101, 29699604, 29768624, 29879116, 29894487, 29995756, 30078983, 30114628, 30237268, 30248387, 30366059, 30428424, 30504920, 30519866, 30576385, 30577658, 30864712, 30918467, 31009059, 31031757, 31106593, 31147381, 31171837, 31285477, 31551515, 31559531, 31621494, 31763714, 31822289, 31862399, 31880859, 31884344, 32154187, 32196098, 32374474, 32401747, 32440094, 32508836, 32570911, 32572902, 32663289, 32801436, 32816392, 32896986, 33033337, 33067627, 33125431, 33156339, 33239683, 33365026, 33441663, 33465050, 33485352, 33495946, 33662681, 33715310, 33776989, 33865295, 33879239, 33945102, 33971977, 33988313, 34014157, 34035116, 34078278, 34174375, 34214498, 34220803, 34312415, 34325599, 34335088, 34363351, 34371884, 34482800, 34509916, 34519176, 34533864, 34602548, 34665696, 34681884, 34745117, 34922604, 34944413, 35034476, 35164139, 35181440, 35185110, 35205376, 35242299, 35319225, 35409006, 35422799, 35441585, 35464466, 35483573, 35565057, 35663306, 35686910, 35798096, 35813663, 35896710, 35960063, 36012132, 36226612, 36307855, 36601116, 36674502, 36768138, 36895571, 37203402, 37286588, 37386070, 37400519, 37402316, 37500699, 37509065, 37588593, 37652021, 37659831, 37795870, 37844465, 37958918, 37972469, 38057698, 38201264, 38203178, 38244764, 38290406, 38442987, 38459704, 39174953, 39272983, 39321955, 39458478, 39519313, 39523420, 39769962, 39773697, 39887543, 40011933, 40145153, 40252899, 40409965, 40442236, 7545093, 7806062, 8225596, 8406859, 9466568, 9528906, 9593769, 9920834
Inflammation	Inhibit	15999041, 25629558, 9119472
Inflammation	Stimulate	17442054, 19277231, 19576497, 22969819, 23408963, 24600034, 24920309, 26345838, 27690673, 27877078, 30100024, 30430410, 30739483, 31350345, 31521202, 32731411, 35502507, 35788177, 39293212
Inflammatory Bowel Diseases	Stimulate	16792690
Inflammatory Bowel Diseases	Associate	7806062
Inflammatory Breast Neoplasms	Associate	35927653, 36592055
Influenza Human	Stimulate	22022504, 9064338
Influenza Human	Associate	25345603
Insulin Resistance	Associate	18270300, 18762729, 22709547, 26839895, 29694633, 33508012
Insulin Resistance	Stimulate	26871994
Intervertebral Disc Degeneration	Associate	32572902, 36746221
Intervertebral disc disease	Associate	30248387, 36293070
Intestinal Pseudo Obstruction	Associate	28323901
Intracranial Aneurysm	Associate	23887838, 26345838, 33332775
Intracranial Arterial Diseases	Stimulate	34476477
Intussusception	Associate	36197260
Irritable Bowel Syndrome	Stimulate	24667736
Job Syndrome	Associate	17881745
Keratoconus	Associate	37460969
Keratoderma Palmoplantar	Associate	33072075
Kidney Diseases	Associate	11012884, 18032547, 20414371, 24382482, 26335292, 37862725, 37942539
Kidney Diseases	Stimulate	12803507, 8995729
Kidney Failure Chronic	Associate	22817530, 25154422, 26335292
Kidney Failure Chronic	Inhibit	31875015
Kidney Failure Chronic	Stimulate	34602548
Labor Pain	Associate	20629487
Lead Poisoning Nervous System	Associate	22992722, 35788177
Leiomyoma	Associate	11591415, 36771423, 9627299
Lentigo	Associate	27314341
Leprosy	Associate	23350010, 34993156, 38244764
Leprosy	Inhibit	23798993
Leprosy	Stimulate	33400985
Leprosy Tuberculoid	Stimulate	14632750
Leukemia	Stimulate	24304929
Leukemia	Associate	30229833
Leukemia Lymphocytic Chronic B Cell	Stimulate	21134984
Leukemia Lymphocytic Chronic B Cell	Associate	25398834, 31409670, 37428863
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23651669
Leukemia Myeloid Acute	Inhibit	19034332
Leukemia Myeloid Acute	Associate	26279521
Leukemia Myeloid Chronic Atypical BCR ABL Negative	Associate	35328046
Leukemia Myelomonocytic Acute	Associate	12829025
Leukemia Myelomonocytic Chronic	Stimulate	30026572
Leukemia Promyelocytic Acute	Associate	33422029
Leukoplakia Oral	Associate	33723932
Lichen Planus	Associate	9856808
Lichen Planus Oral	Associate	30329194
Lipodystrophy	Associate	18430964
Liver Cirrhosis	Associate	21527401
Liver Cirrhosis Alcoholic	Associate	19938194
Liver Cirrhosis Alcoholic	Stimulate	32871288
Liver Diseases	Associate	21760952, 9466568
Liver Diseases Alcoholic	Stimulate	10446112
Liver Diseases Alcoholic	Associate	22861370, 38146363
Lung Diseases	Associate	25289758, 34576979
Lung Diseases Interstitial	Associate	10515417, 20404807, 27906425, 37606981
Lung Injury	Associate	19155472, 35686910
Lung Neoplasms	Associate	24321786, 25744730, 27145753, 27541266
Lung Neoplasms	Stimulate	28968774
Lupus Erythematosus Systemic	Associate	15457456, 18793417, 20414371, 22466290, 27814627, 28954264, 31379847, 34624603
Lupus Erythematosus Systemic	Stimulate	22466290, 24083390, 24292724, 24451065, 24460726, 25401491, 27852285, 31007604, 33708222, 34180358
Lupus Nephritis	Associate	15188361, 15457456, 26762103
Lupus Nephritis	Stimulate	19021013, 25229495, 38441377
Lupus Vasculitis Central Nervous System	Stimulate	16410530
Lyme Disease	Associate	22246581
Lymphangioleiomyomatosis	Associate	19155472
Lymphatic Metastasis	Stimulate	16203990
Lymphatic Metastasis	Associate	18525219, 37132640
Lymphoma	Associate	21744323, 29504848
Lymphoma B Cell	Associate	10193522
Lymphoma Follicular	Associate	22289889
Lymphoma Non Hodgkin	Associate	35328046
Macular Degeneration	Associate	21597483, 23185481, 25503251, 29664944, 31857597, 32485729, 39959181
Macular Degeneration	Stimulate	28231837, 34721402, 34794403, 35352887, 35370941
Macular dystrophy corneal type 1	Stimulate	34794403
Macular Edema	Stimulate	24319335
Majeed syndrome	Associate	33314777
Malaria	Stimulate	22689822
Malformations of Cortical Development Group I	Associate	17284607
Mandibular Nerve Injuries	Stimulate	35775484
Mastocytosis	Stimulate	27856463
Mastocytosis Systemic	Associate	27856463
Melanoma	Associate	12020348, 1731532, 1875058, 21646373, 22498258, 26684239, 32002296, 36087066
Melanoma	Stimulate	35538545
Melanoma	Inhibit	37481560
Melanosis	Associate	35840442
Meningioma	Associate	12117909
Mental Disorders	Associate	16410530
Mesothelioma	Stimulate	21356356
Metabolic Syndrome	Associate	26052894, 29067980
Microcephaly	Inhibit	37766239
Microscopic Polyangiitis	Associate	36726727
Mitochondrial Diseases	Associate	21859809
Mitochondrial Diseases	Stimulate	36361846, 39174953
Mitral Valve Insufficiency	Associate	36307855
Moyamoya Disease	Associate	28072843
Mucocutaneous Lymph Node Syndrome	Associate	10632983, 40455761
Mucocutaneous Lymph Node Syndrome	Stimulate	15608388, 17456996
Multicystic renal dysplasia bilateral	Stimulate	10886563
Multicystic renal dysplasia bilateral	Associate	22744767
Multiple Myeloma	Associate	12644822, 12823344, 15287939, 27983725
Multiple Myeloma	Stimulate	24340030
Multiple Sclerosis	Inhibit	11909910, 16245210, 37047690
Multiple Sclerosis	Associate	16872505, 20456365, 31191554, 37848007, 9916917
Multiple Sclerosis	Stimulate	17284607
Multiple Sclerosis Relapsing Remitting	Associate	23637915
Muscle Neoplasms	Associate	21538317, 29698111
Muscular Atrophy Spinal	Associate	36525882
Muscular Diseases	Associate	28481416
Muscular Dystrophy Duchenne	Associate	36619896
Myasthenia Gravis	Associate	30048972
Myocardial Infarction	Associate	16799229, 31240830, 31772617
Myocardial Infarction	Stimulate	22664781
Myocardial Ischemia	Associate	19639050
Myocarditis	Associate	32963156
Myopathies Structural Congenital	Associate	32910558, 37915048
Myotonic Dystrophy	Inhibit	35363774
Myxoma	Associate	12520153
Nasal Polyps	Stimulate	26067893
Nasal Polyps	Associate	36211987
Nasopharyngeal Carcinoma	Stimulate	28207826
Nasopharyngeal Carcinoma	Associate	37925811
Necrobiotic Xanthogranuloma	Stimulate	24428816
Necrosis	Associate	30048972
Negative rheumatoid factor polyarthritis	Stimulate	16740681
Neointima	Associate	12413001
Neoplasm Metastasis	Associate	12020348, 16849564, 19155472, 19833726, 21135144, 21486440, 21545229, 26996066, 27145753, 27448966, 27541266, 28420351, 28424406, 29115520, 29751565, 30203045, 33514011, 33682749, 36438499, 37248653, 37872588
Neoplasm Metastasis	Stimulate	37445830
Neoplasms	Associate	10623817, 10925276, 11570583, 12731056, 15123743, 15883814, 15900302, 16003740, 16849564, 16866022, 16867220, 17261184, 1731532, 17433654, 18525219, 18697197, 19154405, 19293190, 19833726, 20605053, 21085979, 23090289, 23657965, 24922637, 24970800, 25060177, 25234717, 25318604, 25411415, 25712684, 25938165, 26053616, 26100848, 26416897, 26514518, 26648448, 26684239, 26996066, 27125354, 27145753, 27541266, 27856463, 27888616, 28347237, 28420351, 28424406, 28498437, 28545495, 29115520, 29168083, 29517849, 29722145, 29751565, 29989092, 30254191, 30266096, 30419802, 30683902, 30944146, 31031757, 31183364, 31659097, 31710162, 31763714, 32191346, 32341020, 33047901, 33682749, 33891564, 34020271, 34162860, 34239022, 34534729, 34556549, 34639088, 34837926, 34987659, 35328046, 35449126, 35637530, 35715860, 35851310, 35927653, 35931888, 36923280, 37172580, 37248653, 37264761, 37280393, 37341066, 37352031, 37445830, 37449205, 37515847, 37656220, 38057698, 39756577, 39773697, 9137096, 9627299
Neoplasms	Stimulate	15192307, 15546137, 23684136, 23874805, 26749234, 26889977, 28389503, 33713666
Neoplasms	Inhibit	22699780, 34885960
Neoplasms Adipose Tissue	Associate	22709547, 26514561, 26839895, 31718015, 35894174
Neoplasms Adipose Tissue	Stimulate	23505192
Nephritis	Associate	27814627
Nephrosis Lipoid	Associate	18508485
Nephrotic Syndrome	Stimulate	11012884
Nephrotic Syndrome	Associate	26335292
Nerve Degeneration	Stimulate	34876548
Nervous System Diseases	Associate	23916293
Neural Tube Defects	Associate	18937353
Neuralgia	Associate	35775484, 36860843
Neuroblastoma	Associate	15123743, 25092091, 36923280
Neurocognitive Disorders	Associate	22347417, 25821806
Neurodegenerative Diseases	Associate	22366233, 32515902
Neurofibrosarcoma	Associate	34079083
Neuroinflammatory Diseases	Associate	23198981, 26244388, 37548929
Neurologic Manifestations	Associate	23166687, 26244388
Neurologic Manifestations	Stimulate	34450402
Neuroschistosomiasis	Associate	24189364
Neutropenia	Associate	21437259
Neutrophil Immunodeficiency Syndrome	Associate	38204755
Non alcoholic Fatty Liver Disease	Associate	23405244, 29733805, 38015590
Non alcoholic Fatty Liver Disease	Stimulate	29151327
Obesity	Associate	16059715, 17372317, 18762729, 20117442, 20825686, 20846165, 20930711, 21508136, 22688341, 23017229, 23221346, 28125591, 28454543, 33740174, 35301059, 35894174, 35927653, 36613764, 37149591, 37286588
Obesity	Stimulate	24521217, 26273678, 27101398, 28104240, 29244802, 29737494
Obesity	Inhibit	36428961
Obesity Metabolically Benign	Associate	35685490, 37286588
Obesity Morbid	Stimulate	32545403
Oculocerebrorenal Syndrome	Associate	19755790
Olfaction Disorders	Associate	33629532
Optic Neuropathy Ischemic	Stimulate	21418620
Osteoarthritis	Associate	11352237, 19303468, 23185512, 25407789, 33953899, 34547432, 34876548, 35094658
Osteoarthritis	Stimulate	23274856
Osteoarthritis Knee	Stimulate	21538317, 32006659
Osteoarthritis Knee	Associate	32006659
Osteosarcoma	Associate	31302294, 34335109
Ovarian Cysts	Associate	26003810
Ovarian Neoplasms	Associate	10427991, 10623817, 15900302, 25234717, 25712684, 35186171, 36766725, 37445830, 9137096
Ovarian Neoplasms	Stimulate	31396019
Overweight	Inhibit	37149591
Pain	Associate	22000099, 30248387, 32384383
Pain	Stimulate	34602367
Pancreatic Neoplasms	Associate	25938165, 30397360
Pancreatitis	Associate	18837094
Pancreatitis Chronic	Associate	16394277
Pancreatitis Chronic	Stimulate	18053242
Paraparesis Tropical Spastic	Stimulate	34764955
Parkinson Disease Secondary	Associate	31559531
pediatric multisystem inflammatory disease COVID 19 related	Stimulate	34035116
Pediatric Obesity	Associate	30459472
Peeling Skin Syndrome	Stimulate	32749463
Periodic fever familial autosomal dominant	Associate	31009059, 37500699
Periodontal Diseases	Associate	8225596
Periodontitis	Associate	17533151, 26241961, 28427824
Periodontitis	Stimulate	34502071
Peripheral Arterial Disease	Stimulate	28406704
Peripheral Arterial Disease	Associate	30104096
Peripheral Arterial Occlusive Disease 1	Associate	17598820
Peritoneal Neoplasms	Associate	19938194, 25206284, 26525345
Peritonitis	Associate	19938194, 20143473, 25206284
Peritonitis	Stimulate	34360900
Persistent Infection	Stimulate	32408187
Personality Disorders	Associate	21135144
Placenta Diseases	Associate	30402038
Plaque Atherosclerotic	Associate	1843454, 19506371, 22420243, 31350345
Plasma Cell Granuloma Pulmonary	Associate	9624422
Pleural Effusion	Associate	21356356, 35819097
Pleural Effusion Malignant	Stimulate	18515987
Pneumococcal Infections	Stimulate	37358300
Pneumonia	Stimulate	11179307, 22022504
Polycystic Kidney Autosomal Dominant	Associate	31600749
Polycystic Ovary Syndrome	Associate	25902044, 36793022
Polycythemia Vera	Associate	24463275, 35328046
Polycythemia Vera	Stimulate	35328046
Polyendocrinopathies Autoimmune	Associate	11937582, 33365026
Popliteal Artery Aneurysm	Inhibit	20488324
Post Acute COVID 19 Syndrome	Associate	39578766
Prader Willi Syndrome	Stimulate	25691409
Pre Eclampsia	Associate	28566469
Pre Eclampsia	Stimulate	31521202
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	19388934, 31943135
Primary Graft Dysfunction	Stimulate	18573422
Primary Myelofibrosis	Associate	21442636
Prostate Cancer Hereditary 7	Associate	21135144
Prostatic Hyperplasia	Associate	26306400, 8701989
Prostatic Neoplasms	Associate	16867220, 17216598, 18611860, 18646053, 19866475, 20019839, 21135144, 21545229, 24970800, 25266801, 28039457, 29386061, 29808619, 30864712, 31600936, 31763714, 33050597, 33514011, 33872295, 35821621, 35931888
Prostatic Neoplasms Castration Resistant	Associate	35931888, 38057852
Prosthesis Failure	Stimulate	22131127
Proteinuria	Stimulate	12803507
Proteinuria	Associate	18528327, 26335292
Pseudolymphoma	Associate	10193522
Psoriasis	Associate	15370700, 23480385, 40534874
Psoriasis	Stimulate	23965158
Pulmonary Arterial Hypertension	Associate	24083390
Pulmonary Disease Chronic Obstructive	Associate	14624669, 16213701, 17050556, 17136983, 19165499, 20497022, 24805101, 26514518, 29872287, 34325599, 36780897
Pulmonary Disease Chronic Obstructive	Stimulate	19229703, 21097527, 21327296
Pulmonary edema of mountaineers	Associate	34483727
Pulmonary Embolism	Stimulate	26667361, 33969714
Pulmonary Embolism	Associate	33810533
Pulmonary Fibrosis	Associate	10403930, 12449175
Pulmonary Fibrosis	Stimulate	19729668
Pulpitis	Associate	33046027
Pyelonephritis	Associate	30905425
Pyruvate Carboxylase Deficiency Disease	Stimulate	22473609
Pyruvate Carboxylase Deficiency Disease	Associate	36224527
Q Fever	Associate	31001808
Radiation Pneumonitis	Associate	34964782
Raynaud Disease	Stimulate	38302542
Renal Insufficiency	Associate	17982227, 33166788
Renal Insufficiency Chronic	Associate	16609683, 27569940, 29016630, 33139635
Renal Insufficiency Chronic	Inhibit	30280599
Renal Insufficiency Chronic	Stimulate	32046176, 33974569
Reperfusion Injury	Stimulate	21900689
Reperfusion Injury	Associate	32696819, 37735391
Respiratory Distress Syndrome	Stimulate	18266131, 27496101
Respiratory Insufficiency	Stimulate	21906274
Respiratory Insufficiency	Associate	23840697
Respiratory Tract Diseases	Associate	23181789
Respiratory Tract Infections	Associate	34987646
Retinal Detachment	Stimulate	17284607, 32542038, 33371882
Retinal Detachment	Associate	34544594
Retinal Necrosis Syndrome Acute	Stimulate	28395298
Retinal Perforations	Stimulate	35409006
Retinal Vein Occlusion	Associate	25978399, 35370941
Rhinitis Allergic	Associate	17982926
Rupture	Associate	22664781
Sarcoidosis	Stimulate	10515417, 12449175, 27259755, 9528906
Sarcoidosis	Associate	24768588
Sarcoma Ewing	Stimulate	33682749
Sarcoma Kaposi	Associate	23818101
Schizophrenia	Inhibit	24984193, 39940697
Scleroderma Localized	Stimulate	37471168
Scleroderma Systemic	Stimulate	10403930, 23897225, 24083390, 35674522
Scleroderma Systemic	Associate	15654958, 32317146, 37246768, 40534874
Sclerosis	Associate	15654958
Sepsis	Associate	28472164, 34624603, 35960063
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Shock Septic	Associate	28472164, 35960063
Sickle Cell Trait	Associate	37533140
Sjogren's Syndrome	Associate	29504848, 38255988
Skin Abnormalities	Associate	15370700
Skin Diseases	Associate	17606602, 28954264
Skin Manifestations	Associate	25839768
Sleep Apnea Obstructive	Associate	22761257, 39252231
Smooth Muscle Tumor	Associate	24931417
Spinal Cord Injuries	Associate	35802304
Spinal Dysraphism	Associate	18937353
Splenomegaly	Associate	21442636
Squamous Cell Carcinoma of Head and Neck	Associate	11570583, 18525219, 24586454, 25060177, 28533507, 30192802
Squamous Cell Carcinoma of Head and Neck	Stimulate	27888616
ST Elevation Myocardial Infarction	Associate	25503660, 31077149
Status Asthmaticus	Stimulate	14968124, 24931417
Status Asthmaticus	Associate	27906425, 28168862
Status Asthmaticus	Inhibit	37149591
Still's Disease Adult Onset	Stimulate	37500699
Stomach Neoplasms	Associate	24764682, 25411415, 26438062, 26648448, 29989092, 35000531, 35851310
Stomach Ulcer	Associate	15115316
Stress Disorders Post Traumatic	Stimulate	30777365
Stroke	Associate	17183455, 19292924, 35638254
Stroke	Stimulate	19755790
Subarachnoid Hemorrhage	Associate	27576738
Syndrome	Stimulate	23028541
Synovial Cyst	Associate	38181585
Systemic Inflammatory Response Syndrome	Inhibit	11909910
Systemic Inflammatory Response Syndrome	Associate	16566827
Takayasu Arteritis	Associate	34014157, 34079541
Takotsubo Cardiomyopathy	Stimulate	32963156
Temporomandibular Joint Disorders	Stimulate	22000099
Tertiary Lymphoid Structures	Stimulate	15192307
Testicular Germ Cell Tumor	Associate	37352031
Testicular Neoplasms	Associate	37352031
Thrombocythemia Essential	Stimulate	24463275
Thrombocytopenia	Associate	20414371
Thrombosis	Associate	22942727, 25657311, 25988387, 36226612
Thyroid Cancer Papillary	Stimulate	16203990
Thyroiditis Autoimmune	Associate	27245471
Tissue Adhesions	Associate	37385390
Tongue Neoplasms	Associate	37132640
Tooth Loss	Associate	26241961
Trauma Nervous System	Stimulate	23840697
Tremor	Inhibit	30852582
Trigeminal Neuralgia	Stimulate	34067581
Triple Negative Breast Neoplasms	Associate	29594759, 30059519, 31665136, 32627003, 33587979, 34848446, 35715860, 36347994
Triple Negative Breast Neoplasms	Stimulate	35268073
Tuberculosis	Associate	16352737, 19439012, 20041183, 20111728, 21504590, 21556333, 22992722, 23166687, 25378811, 25966175, 33381602
Tuberculosis	Stimulate	18940815
Tuberculosis Meningeal	Associate	21556333, 33381602
Tuberculosis Pulmonary	Associate	16352737, 18940815, 20111728, 21504590, 21760952, 22240432, 25753871, 25966175, 33381602
Tuberous Sclerosis	Associate	19912235
Ulcer	Associate	22688339
Urinary Bladder Neoplasms	Stimulate	11904733
Urinary Bladder Neoplasms	Associate	20449800, 28618950, 30310111, 34893045, 37915048
Urinary Bladder Overactive	Associate	32080289
Urinary Tract Infections	Associate	20526368
Uterine Cervical Neoplasms	Associate	16803512
Uterine Diseases	Stimulate	26586929
Uterine Neoplasms	Associate	11591415
Uveal melanoma	Associate	22429778
Uveitis	Associate	15115316, 16280979, 20097750
Uveitis	Stimulate	35061677
Uveitis Anterior	Associate	16280979, 34294770
Varicose Veins	Stimulate	19729323
Varicose Veins	Associate	28623996
Vascular Calcification	Associate	23115640
Vascular Diseases	Associate	16566827, 18453576, 22366233, 23704830, 34079541, 34509916
Vascular Diseases	Stimulate	17717122
Vascular Diseases	Inhibit	40508061
Vascular Remodeling	Associate	26667361
Vascular Ring	Associate	35712246
Vasculitis	Associate	29720895
Ventricular Dysfunction Left	Associate	19632522
Viremia	Stimulate	16916890
Viremia	Associate	29768624
Virus Diseases	Associate	12374865
Vitelliform Macular Dystrophy	Stimulate	34794403
Vitreoretinopathy Proliferative	Stimulate	17194635, 28572674
Weight Loss	Inhibit	21147860, 23378611
Wieacker syndrome	Associate	27070589
Xanthomatosis	Associate	24428816
Zika Virus Infection	Inhibit	37766239