CCL1 (C-C motif chemokine ligand 1)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6346
Gene name Gene Name - the full gene name approved by the HGNC.
C-C motif chemokine ligand 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CCL1
Synonyms (NCBI Gene) Gene synonyms aliases
I-309, P500, SCYA1, SISe, TCA3
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
miRTarBase ID miRNA Experiments Reference
MIRT000257 hsa-miR-17-5p Luciferase reporter assay 19734348
MIRT440987 hsa-miR-106b-5p HITS-CLIP 22473208
MIRT440986 hsa-miR-20a-5p HITS-CLIP 22473208
MIRT440985 hsa-miR-21-5p HITS-CLIP 22473208
MIRT440987 hsa-miR-106b-5p HITS-CLIP 22473208
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(27)
GO ID Ontology Definition Evidence Reference
GO:0002548 Process Monocyte chemotaxis IBA 21873635
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0005615 Component Extracellular space IDA 1557400
GO:0006874 Process Cellular calcium ion homeostasis TAS 9417093
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
182281 10609 ENSG00000108702
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P22362
Protein name C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)
Protein function Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
PDB 1EL0 , 4OIJ , 4OIK , 8U1U
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00048 IL8 31 → 88 Small cytokines (intecrine/chemokine), interleukin-8 like Domain
Sequence 
MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Sequence length 96
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway 		  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Glomerulonephritis Glomerulonephritis rs778043831 10385480
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 30579999 ClinVar
Show/Hide Text Mining Associations (47)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 27524264
Adenocarcinoma of Lung Associate 27524264, 34745015
Allergic Fungal Sinusitis Inhibit 20598643
Alzheimer Disease Associate 27229914
Asthma Stimulate 18684970
Asthma Associate 19152963
Ataxia Telangiectasia Associate 19152963
Behcet Syndrome Inhibit 24984193
Breast Neoplasms Associate 30572845, 36694223
Carcinoma Transitional Cell Associate 26548923