CCL1 (C-C motif chemokine ligand 1)

Gene

• Entrez ID: 6346
• Gene name: C-C motif chemokine ligand 1
• Gene symbol: CCL1
• Synonyms (NCBI Gene): I-309, P500, SCYA1, SISe, TCA3
• Chromosome: 17
• Chromosome location: 17q12
• Summary: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000257	hsa-miR-17-5p	Luciferase reporter assay	19734348
MIRT440987	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440986	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440985	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT440987	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT000257	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT728035	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT728034	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT728033	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440986	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT440985	hsa-miR-21-5p	HITS-CLIP	22473208
MIRT732839	hsa-miR-19b-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33364805
MIRT2446456	hsa-miR-21	CLIP-seq
MIRT2446457	hsa-miR-590-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	1557400
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2212659
GO:0006874	Process	Intracellular calcium ion homeostasis	TAS	9417093
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	9417093
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	9417093
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	1557400
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	1557400
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	9417093
GO:0016032	Process	Viral process	TAS	9417093
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	28972028
GO:0048020	Function	CCR chemokine receptor binding	IBA
GO:0048245	Process	Eosinophil chemotaxis	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	28972028
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	1557400

Other IDs

• MIM: 182281
• HGNC: 10609
• e!Ensembl: ENSG00000108702

Protein

• UniProt ID: P22362
• Protein name: C-C motif chemokine 1 (Small-inducible cytokine A1) (T lymphocyte-secreted protein I-309)
• Protein function: Cytokine that is chemotactic for monocytes but not for neutrophils. Binds to CCR8.
• PDB: 1EL0, 4OIJ, 4OIK, 8U1U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00048	IL8	31 → 88	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

• Sequence:

  MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNE
  GLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK

• Sequence length: 96

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Chemokine signaling pathway

Reactome:

Chemokine receptors bind chemokines
G alpha (i) signalling events

<