SCT (secretin)

Gene

• Entrez ID: 6343
• Gene name: Secretin
• Gene symbol: SCT
• Synonyms (NCBI Gene): -
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes a member of the glucagon family of peptides. The encoded preproprotein is secreted by endocrine S cells in the proximal small intestinal mucosa as a prohormone, then proteolytically processed to generate the mature peptide hormone. The r

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1330948	hsa-miR-361-3p	CLIP-seq
MIRT1330949	hsa-miR-4722-3p	CLIP-seq
MIRT1330950	hsa-miR-4793-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	15118068
SP3	Unknown	15118068

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	7612008
GO:0002024	Process	Diet induced thermogenesis	ISS
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	ISS
GO:0005179	Function	Hormone activity	NAS	11060443
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	32811827
GO:0007420	Process	Brain development	IBA
GO:0009992	Process	Intracellular water homeostasis	IEA
GO:0009992	Process	Intracellular water homeostasis	ISS
GO:0021766	Process	Hippocampus development	ISS
GO:0030157	Process	Pancreatic juice secretion	NAS	11060443
GO:0031667	Process	Response to nutrient levels	ISS
GO:0032098	Process	Regulation of appetite	ISS
GO:0046659	Function	Digestive hormone activity	IEA
GO:0046659	Function	Digestive hormone activity	ISS
GO:0048167	Process	Regulation of synaptic plasticity	ISS
GO:0048566	Process	Embryonic digestive tract development	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	ISS
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IBA
GO:0090187	Process	Positive regulation of pancreatic juice secretion	IEA
GO:0090274	Process	Positive regulation of somatostatin secretion	IBA
GO:0090274	Process	Positive regulation of somatostatin secretion	IEA
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IEA
GO:1903640	Process	Negative regulation of gastrin-induced gastric acid secretion	IBA
GO:1903640	Process	Negative regulation of gastrin-induced gastric acid secretion	IEA

Other IDs

• MIM: 182099
• HGNC: 10607
• e!Ensembl: ENSG00000070031

Protein

• UniProt ID: P09683
• Protein name: Secretin
• Protein function: Hormone involved in different processes, such as regulation of the pH of the duodenal content, food intake and water homeostasis (PubMed:25332973). Exerts its biological effects by binding to secretin receptor (SCTR), a G-protein coupled recepto
• PDB: 6WI9, 6WZG, 7D3S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00123	Hormone_2	28 → 55	Peptide hormone	Family

• Sequence:

  MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQ
  DAENSMAWTRLSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRP
  R

• Sequence length: 121

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Pancreatic secretion
Bile secretion

Reactome:

G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production

<