Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	634
Gene name Gene Name - the full gene name approved by the HGNC.	CEA cell adhesion molecule 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CEACAM1
Synonyms (NCBI Gene) Gene synonyms aliases	BGP, BGP1, BGPI
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily. Two subgroups of the CEA family, the CEA cell adhesion molecules and the pregnancy-specific glycoproteins, are located within a

Show/Hide all(7)

miRTarBase ID	miRNA	Experiments
MIRT882915	hsa-miR-1343	CLIP-seq
MIRT882916	hsa-miR-3074-5p	CLIP-seq
MIRT882917	hsa-miR-520d-5p	CLIP-seq
MIRT882918	hsa-miR-524-5p	CLIP-seq
MIRT882919	hsa-miR-935	CLIP-seq
MIRT2198338	hsa-miR-1270	CLIP-seq
MIRT2198339	hsa-miR-620	CLIP-seq

Transcription factors

Show/Hide all(8)

Transcription factor	Regulation	Reference
HNF4A	Activation	8055923
IRF1	Activation	21050451
NFKB1	Activation	11306560
RELA	Activation	11306560
SOX9	Unknown	22209504
SP2	Repression	15126343
USF1	Activation	21050451;8055923
USF2	Activation	8055923

Show/Hide all(74)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	NAS	15687237
GO:0001558	Process	Regulation of cell growth	ISS
GO:0001568	Process	Blood vessel development	ISS
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IDA	18424730
GO:0002859	Process	Negative regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	23696226
GO:0003674	Function	Molecular_function	ND
GO:0003779	Function	Actin binding	IPI	17192268
GO:0005515	Function	Protein binding	IPI	11035932, 11994468, 16246332, 16282604, 18424730, 18497748, 21982860, 23696226, 25363763
GO:0005516	Function	Calmodulin binding	ISS
GO:0005886	Component	Plasma membrane	IDA	17192268
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	NAS	15687237
GO:0005911	Component	Cell-cell junction	IDA	16291724
GO:0005912	Component	Adherens junction	ISS
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0007155	Process	Cell adhesion	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	ISS
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	NAS	15687237
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	15687237
GO:0009925	Component	Basal plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	25363763
GO:0009986	Component	Cell surface	ISS
GO:0010594	Process	Regulation of endothelial cell migration	ISS
GO:0014066	Process	Regulation of phosphatidylinositol 3-kinase signaling	ISS
GO:0015125	Function	Bile acid transmembrane transporter activity	ISS
GO:0015721	Process	Bile acid and bile salt transport	ISS
GO:0016020	Component	Membrane	TAS	2457922
GO:0016021	Component	Integral component of membrane	IDA	11994468
GO:0016324	Component	Apical plasma membrane	IDA	10436421
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016328	Component	Lateral plasma membrane	ISS
GO:0016477	Process	Cell migration	NAS	15687237
GO:0019900	Function	Kinase binding	IPI	7478590
GO:0019903	Function	Protein phosphatase binding	IPI	18424730
GO:0030054	Component	Cell junction	IDA	8018919
GO:0030054	Component	Cell junction	ISS
GO:0030334	Process	Regulation of cell migration	IDA	16291724
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030853	Process	Negative regulation of granulocyte differentiation	ISS
GO:0031005	Function	Filamin binding	IPI	16291724
GO:0031528	Component	Microvillus membrane	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0035579	Component	Specific granule membrane	TAS
GO:0035726	Process	Common myeloid progenitor cell proliferation	ISS
GO:0038016	Process	Insulin receptor internalization	ISS
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	ISS
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	ISS
GO:0042101	Component	T cell receptor complex	IDA	18424730
GO:0042802	Function	Identical protein binding	IDA	26483485
GO:0042802	Function	Identical protein binding	IPI	19948502
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043116	Process	Negative regulation of vascular permeability	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043318	Process	Negative regulation of cytotoxic T cell degranulation	IDA	18424730
GO:0044319	Process	Wound healing, spreading of cells	IDA	16291724
GO:0045601	Process	Regulation of endothelial cell differentiation	ISS
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	ISS
GO:0046983	Function	Protein dimerization activity	ISS
GO:0050860	Process	Negative regulation of T cell receptor signaling pathway	IDA	18424730
GO:0050900	Process	Leukocyte migration	TAS
GO:0051055	Process	Negative regulation of lipid biosynthetic process	ISS
GO:0060312	Process	Regulation of blood vessel remodeling	ISS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	ISS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0090331	Process	Negative regulation of platelet aggregation	ISS
GO:0098742	Process	Cell-cell adhesion via plasma-membrane adhesion molecules	ISS
GO:1901143	Process	Insulin catabolic process	ISS
GO:1903385	Process	Regulation of homophilic cell adhesion	ISS
GO:1903670	Process	Regulation of sprouting angiogenesis	ISS
GO:1990782	Function	Protein tyrosine kinase binding	IPI	18424730
GO:2000346	Process	Negative regulation of hepatocyte proliferation	ISS
GO:2001214	Process	Positive regulation of vasculogenesis	ISS

MIM	HGNC	e!Ensembl
109770	1814	ENSG00000079385

Protein

UniProt ID

P13688

Protein name

Cell adhesion molecule CEACAM1 (Biliary glycoprotein 1) (BGP-1) (Carcinoembryonic antigen-related cell adhesion molecule 1) (CEA cell adhesion molecule 1) (CD antigen CD66a)

Protein function

[Isoform 1]: Cell adhesion protein that mediates homophilic cell adhesion in a calcium-independent manner (By similarity). Plays a role as coinhibitory receptor in immune response, insulin action and also functions as an activator during angioge

PDB

2GK2 , 4QXW , 4WHD , 5DZL , 6AW2 , 6GBG , 6GBH , 6V3P , 6XNO , 6XNT , 6XNW , 6XO1 , 7MU8 , 7RPP , 8CXJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	38 → 141	Immunoglobulin V-set domain	Domain
PF13927	Ig_3	146 → 219		Domain
PF13895	Ig_2	239 → 318	Immunoglobulin domain	Domain
PF00047	ig	331 → 411	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in columnar epithelial cells of the colon (at protein level) (PubMed:10436421). The predominant forms expressed by T cells are those containing a long cytoplasmic domain (PubMed:18424730). Expressed in granulocytes and lympho

Sequence

MGHLSAPLHRVRVPWQGLLLTASLLTFWNPPTTAQLTTESMPFNVAEGKEVLLLVHNLPQ
QLFGYSWYKGERVDGNRQIVGYAIGTQQATPGPANSGRETIYPNASLLIQNVTQNDTGFY
TLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPETQDTTYLWWI
NNQSLPVSPRLQLSNGNRTLTLLSVTRNDTGPYECEIQNPVSANRSDPVTLNVTYGPDTP
TISPSDTYYRPGANLSLSCYAASNPPAQYSWLINGTFQQSTQELFIPNITVNNSGSYTCH
ANNSVTGCNRTTVKTIIVTELSPVVAKPQIKASKTTVTGDKDSVNLTCSTNDTGISIRWF
FKNQSLPSSERMKLSQGNTTLSINPVKREDAGTYWCEVFNPISKNQSDPIMLNVNYNALP
QENGLSPGAIAGIVIGVVALVALIAVALACFLHFGKTGRASDQRDLTEHKPSVSNHTQDH
SNDPPNKMNEVTYSTLNFEAQQPTQPTSASPSLTATEIIYSEVKKQ

Sequence length

526

Interactions

View interactions

	Reactome
			Fibronectin matrix formation Cell surface interactions at the vascular wall Neutrophil degranulation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenocarcinoma, Adenocarcinoma, Basal Cell, Adenocarcinoma, Oxyphilic, Adenocarcinoma, Tubular	rs121913530, rs886039394, rs121913474	21552421
Carcinoma	Carcinoma, Cribriform, Carcinoma, Granular Cell	rs121912654, rs555607708, rs786202962, rs1564055259	21552421
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	21552421

Show/Hide Text Mining Associations (83)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute On Chronic Liver Failure	Associate	33717119
Adenocarcinoma	Associate	19331157, 29414601
Adenocarcinoma of Lung	Associate	20090913
Adenoma	Inhibit	20524097
Alcohol fetopathy	Inhibit	32326243
Arthritis Juvenile	Associate	38243323
Arthritis Rheumatoid	Stimulate	36591283
Arthritis Rheumatoid	Associate	39354368
Blood Platelet Disorders	Associate	26367242
Brain Neoplasms	Associate	26277786
Breast Neoplasms	Associate	18507857, 21398516, 27302061, 27302063, 28823832
Breast Neoplasms	Inhibit	24302721, 26341981, 9626043
Calcinosis Cutis	Associate	19331157
Carcinogenesis	Associate	10666389, 21398516, 27302063, 31171910, 37691945
Carcinogenesis	Stimulate	28655144
Carcinogenesis	Inhibit	7504281
Carcinoid Tumor	Associate	24518592
Carcinoma	Associate	31171910
Carcinoma Hepatocellular	Associate	15952183, 24390710, 28975984
Carcinoma Non Small Cell Lung	Associate	23885995, 35449849
Carcinoma Renal Cell	Associate	21082031, 36712923
Cardiovascular Diseases	Associate	23521917, 34639156
Cerebral Infarction	Stimulate	35657334
Colitis Ulcerative	Inhibit	19637360
Colitis Ulcerative	Associate	23745037
Colonic Neoplasms	Inhibit	18507857
Colorectal Neoplasms	Associate	10666389, 11384100, 20524097, 28402947, 34394073, 35285580, 8910434
Colorectal Neoplasms	Inhibit	20524097
COVID 19	Associate	37302069, 37351167
Crohn Disease	Inhibit	19637360
Cytomegalovirus Infections	Stimulate	12370272
Diabetes Gestational	Inhibit	32326243
Diabetes Mellitus	Associate	20714323
Diabetes Mellitus Type 2	Associate	32326243
Endometrial Neoplasms	Associate	7690349, 9626043
Fatty Liver	Inhibit	21569294
Gastrointestinal Neoplasms	Associate	28655144
Helicobacter Infections	Associate	30778796
Hypoxia	Associate	35812245, 36694434
Hypoxia Brain	Stimulate	35812245
IgA Vasculitis	Associate	36591283
Inflammation	Associate	31072323, 34394073, 35657334, 36591283, 37589542, 37691945
Inflammatory Bowel Diseases	Associate	19637360, 34301333, 34394073
Insulin Resistance	Associate	19763090, 21569294
Leukemia Myeloid Acute	Associate	36212177
Lung Neoplasms	Associate	18927117, 20090913, 21050451, 35449849
Lymphatic Metastasis	Stimulate	19331157, 24587171
Mastocytosis	Associate	28332308
Melanoma	Associate	12370272, 15509546, 19633846, 21050451, 26277786, 26448580, 26885752, 29558679, 29720400
Melanoma	Stimulate	18557789
Meningococcal Infections	Associate	10816518
Metabolic Diseases	Associate	20714323
Mouth Neoplasms	Associate	37589542
Multiple Myeloma	Associate	11948796, 29486474
Necrosis	Associate	37589542
Neoplasm Metastasis	Associate	15509546, 19331157, 26646010, 36712923
Neoplasms	Associate	11384100, 14602915, 16504122, 19331157, 20090913, 20714323, 21082031, 23885995, 24587171, 26341981, 26469833, 27377843, 28332308, 28655144, 28975984 View all (12 more)
Neoplasms	Inhibit	12122002, 14604968, 15952183, 18445773, 18507857, 20524097, 21050451, 29486474
Neoplasms	Stimulate	30995063
Obesity	Associate	19763090
Obesity	Inhibit	21569294
Osteoarthritis	Inhibit	27999816
Osteoglophonic dwarfism	Stimulate	35812245
Ovarian Neoplasms	Associate	30050594, 40307488
Papillomavirus Infections	Associate	16924126
Precancerous Conditions	Associate	31171910
Prostatic Neoplasms	Associate	12122002, 20386565
Prostatitis	Inhibit	12122002, 8910434
Prostatitis	Associate	27302061
Proteinuria	Associate	39378116
Recurrent respiratory papillomatosis	Associate	34337750
Renal Insufficiency	Associate	39378116
Ring Chromosome 20 Syndrome	Stimulate	35812245
Sepsis	Associate	31093495
Squamous Cell Carcinoma of Head and Neck	Associate	24587171, 30431092, 36268020
Squamous Intraepithelial Lesions	Stimulate	16924126
Stomach Neoplasms	Associate	30778796, 33611641, 36430322, 36680216
Thyroid cancer medullary	Associate	28332308
Tuberculosis	Associate	33328540
Urinary Bladder Neoplasms	Associate	33238953
Uterine Cervical Dysplasia	Associate	31171910
Uterine Cervical Neoplasms	Associate	16924126, 7690349
Waldenstrom Macroglobulinemia	Associate	11948796

CEACAM1 (CEA cell adhesion molecule 1)