Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6319
Gene name Gene Name - the full gene name approved by the HGNC.
Stearoyl-CoA desaturase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SCD
Synonyms (NCBI Gene) Gene synonyms aliases
FADS5, MSTP008, SCD1, SCDOS, hSCD1
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approx
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017330 hsa-miR-335-5p Microarray 18185580
MIRT020585 hsa-miR-155-5p Proteomics 18668040
MIRT024946 hsa-miR-215-5p Microarray 19074876
MIRT025105 hsa-miR-181a-5p Sequencing 20371350
MIRT026303 hsa-miR-192-5p Microarray 19074876
Transcription factors
Transcription factor Regulation Reference
RARA Activation 11397803
SREBF1 Unknown 11414710
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004768 Function Stearoyl-CoA 9-desaturase activity IBA 21873635
GO:0004768 Function Stearoyl-CoA 9-desaturase activity IDA 15907797, 18765284
GO:0005506 Function Iron ion binding IBA 21873635
GO:0005506 Function Iron ion binding IDA 18765284
GO:0005515 Function Protein binding IPI 30177828, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604031 10571 ENSG00000099194
Protein
UniProt ID O00767
Protein name Stearoyl-CoA desaturase (hSCD1) (EC 1.14.19.1) (Acyl-CoA desaturase) (Delta(9)-desaturase) (Delta-9 desaturase) (Fatty acid desaturase)
Protein function Stearoyl-CoA desaturase that utilizes O(2) and electrons from reduced cytochrome b5 to introduce the first double bond into saturated fatty acyl-CoA substrates (PubMed:15907797, PubMed:18765284). Catalyzes the insertion of a cis double bond at t
PDB 4ZYO
Family and domains
Tissue specificity TISSUE SPECIFICITY: Detected in fetal liver, lung and brain. Highly expressed in adult adipose tissue, and at lower levels in adult brain and lung. {ECO:0000269|PubMed:15907797}.
Sequence
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFVSALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWGE
TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
Sequence length 359
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Biosynthesis of unsaturated fatty acids
Metabolic pathways
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Alcoholic liver disease
  Activation of gene expression by SREBF (SREBP)
Fatty acyl-CoA biosynthesis
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Carcinoma Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma rs121912654, rs555607708, rs786202962, rs1564055259 12376462, 16316942
Associations from Text Mining
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 16213227
Acidosis Stimulate 35046108
Adenocarcinoma Associate 39351232
Adenocarcinoma of Lung Associate 33264619
Atherosclerosis Associate 31119852, 31965762
Bipolar Disorder Associate 31455761
Bone Diseases Inhibit 32454462
Breast Neoplasms Associate 20876744, 23013158, 23208590, 23613812, 25880005, 26022099, 26061164, 27306423, 31182966, 37122728
Breast Neoplasms Stimulate 34030117
Carcinogenesis Associate 23331615, 24135379, 26391970, 35046108, 38003694