Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6318
Gene name	Serpin family B member 4
Gene symbol	SERPINB4
Synonyms (NCBI Gene)	LEUPINPI11SCCA-2SCCA1SCCA2
Chromosome	18
Chromosome location	18q21.33
Summary	The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein is highly expressed in many tumor cells and can inactivate granzyme M, an enzyme that kills tumor cells. This protein, along with serpin B

Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT443446	hsa-miR-4517	PAR-CLIP	22100165
MIRT443445	hsa-miR-3123	PAR-CLIP	22100165
MIRT443444	hsa-miR-556-5p	PAR-CLIP	22100165
MIRT443443	hsa-miR-6807-5p	PAR-CLIP	22100165
MIRT2100127	hsa-miR-4263	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2100129	hsa-miR-4799-5p	CLIP-seq
MIRT2100130	hsa-miR-576-5p	CLIP-seq
MIRT2325020	hsa-miR-4282	CLIP-seq
MIRT2100128	hsa-miR-4719	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq
MIRT2620601	hsa-miR-3671	CLIP-seq
MIRT2620602	hsa-miR-607	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	21857942
GO:0004866	Function	Endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	21857942
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	NAS	7589435
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0010466	Process	Negative regulation of peptidase activity	IDA	12949073
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0030162	Process	Regulation of proteolysis	NAS	7589435
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0042270	Process	Protection from natural killer cell mediated cytotoxicity	IMP	21857942

MIM	HGNC	e!Ensembl
600518	10570	ENSG00000206073

P48594

Protein name

Serpin B4 (Leupin) (Peptidase inhibitor 11) (PI-11) (Squamous cell carcinoma antigen 2) (SCCA-2)

Protein function

May act as a protease inhibitor to modulate the host immune response against tumor cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00079	Serpin	6 → 390	Serpin (serine protease inhibitor)	Domain

Tissue specificity

TISSUE SPECIFICITY: Squamous cells.

Sequence

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQISKVLHFD
QVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYQFLQEYL
DAIKKFYQTSVESTDFANAPEESRKKINSWVESQTNEKIKNLFPDGTIGNDTTLVLVNAI
YFKGQWENKFKKENTKEEKFWPNKNTYKSVQMMRQYNSFNFALLEDVQAKVLEIPYKGKD
LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETCVDLHLPRFKMEESYDLKDTLR
TMGMVNIFNGDADLSGMTWSHGLSVSKVLHKAFVEVTEEGVEAAAATAVVVVELSSPSTN
EEFCCNHPFLFFIRQNKTNSILFYGRFSSP

Sequence length

390

Interactions

View interactions

	KEGG
	Amoebiasis

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Prostate cancer	Uncertain significance	rs193921093	RCV000149140

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Allergic Fungal Sinusitis	Associate	19153309, 22508623
Bowen's Disease	Associate	36085041
Carcinogenesis	Stimulate	17291250, 17638865
Carcinoma Non Small Cell Lung	Associate	36791109
Carcinoma Squamous Cell	Associate	10867615, 21857942, 36085041
Cholesteatoma	Associate	23285167
Crohn Disease	Associate	39838210
Dermatitis Atopic	Associate	28734739
Idiopathic Pulmonary Fibrosis	Associate	37858084
Infections	Associate	10683336
Inflammation	Associate	22508623, 36791109, 39838210, 8999871
Inflammatory Bowel Diseases	Associate	39838210
Melanoma	Associate	27668655, 35085295, 36553569
Neoplasms	Stimulate	17291250, 17638865, 30045992
Neoplasms	Associate	21857942, 26963506, 26993499
Neurofibrosarcoma	Associate	33831431
Squamous Cell Carcinoma of Head and Neck	Associate	16006770, 22922995, 22937809
Uterine Cervical Neoplasms	Stimulate	17291250
Uterine Cervical Neoplasms	Associate	29112685

SERPINB4 (serpin family B member 4)