Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6303
Gene name Gene Name - the full gene name approved by the HGNC.	Spermidine/spermine N1-acetyltransferase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SAT1
Synonyms (NCBI Gene) Gene synonyms aliases	DC21, KFSD, KFSDX, SAT, SSAT, SSAT-1
Disease Acronyms (UniProt) Disease acronyms from UniProt database	KFSDX
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp22.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the acetyltransferase family, and is a rate-limiting enzyme in the catabolic pathway of polyamine metabolism. It catalyzes the acetylation of spermidine and spermine, and is involved in the regulation of the int

Show/Hide all(125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019180	hsa-miR-335-5p	Microarray	18185580
MIRT026968	hsa-miR-107	Microarray	20489155
MIRT048548	hsa-miR-100-5p	CLASH	23622248
MIRT039551	hsa-miR-652-3p	CLASH	23622248
MIRT037883	hsa-miR-455-3p	CLASH	23622248
MIRT037497	hsa-miR-744-5p	CLASH	23622248
MIRT504006	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT504004	hsa-miR-1244	PAR-CLIP	21572407
MIRT504003	hsa-miR-4477a	PAR-CLIP	21572407
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT504004	hsa-miR-1244	PAR-CLIP	21572407
MIRT504003	hsa-miR-4477a	PAR-CLIP	21572407
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT504006	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT504005	hsa-miR-551b-5p	PAR-CLIP	23446348
MIRT504004	hsa-miR-1244	PAR-CLIP	23446348
MIRT504003	hsa-miR-4477a	PAR-CLIP	23446348
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT1326587	hsa-miR-186	CLIP-seq
MIRT1326588	hsa-miR-199a-5p	CLIP-seq
MIRT1326589	hsa-miR-199b-5p	CLIP-seq
MIRT1326590	hsa-miR-3177-5p	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT1326593	hsa-miR-4302	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT1326597	hsa-miR-618	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617526	hsa-miR-1	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2617527	hsa-miR-139-5p	CLIP-seq
MIRT1326588	hsa-miR-199a-5p	CLIP-seq
MIRT1326589	hsa-miR-199b-5p	CLIP-seq
MIRT2617528	hsa-miR-206	CLIP-seq
MIRT2617529	hsa-miR-217	CLIP-seq
MIRT2617530	hsa-miR-3064-3p	CLIP-seq
MIRT2617531	hsa-miR-3121-3p	CLIP-seq
MIRT2617532	hsa-miR-3156-5p	CLIP-seq
MIRT1326590	hsa-miR-3177-5p	CLIP-seq
MIRT2617533	hsa-miR-3200-5p	CLIP-seq
MIRT2617534	hsa-miR-320a	CLIP-seq
MIRT2617535	hsa-miR-320b	CLIP-seq
MIRT2617536	hsa-miR-320c	CLIP-seq
MIRT2617537	hsa-miR-320d	CLIP-seq
MIRT2617538	hsa-miR-323b-5p	CLIP-seq
MIRT2617539	hsa-miR-3673	CLIP-seq
MIRT2617540	hsa-miR-3689d	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT2617541	hsa-miR-4251	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2617542	hsa-miR-4272	CLIP-seq
MIRT1326593	hsa-miR-4302	CLIP-seq
MIRT2617543	hsa-miR-4329	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT2617544	hsa-miR-4428	CLIP-seq
MIRT2617545	hsa-miR-4429	CLIP-seq
MIRT2617546	hsa-miR-4490	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT2617547	hsa-miR-4522	CLIP-seq
MIRT2617548	hsa-miR-4715-3p	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2617549	hsa-miR-4799-5p	CLIP-seq
MIRT2617550	hsa-miR-4802-5p	CLIP-seq
MIRT2617551	hsa-miR-515-5p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617552	hsa-miR-613	CLIP-seq
MIRT1326597	hsa-miR-618	CLIP-seq
MIRT2617526	hsa-miR-1	CLIP-seq
MIRT1326586	hsa-miR-1283	CLIP-seq
MIRT2617527	hsa-miR-139-5p	CLIP-seq
MIRT2617528	hsa-miR-206	CLIP-seq
MIRT2617529	hsa-miR-217	CLIP-seq
MIRT2617530	hsa-miR-3064-3p	CLIP-seq
MIRT2617531	hsa-miR-3121-3p	CLIP-seq
MIRT2617533	hsa-miR-3200-5p	CLIP-seq
MIRT2617534	hsa-miR-320a	CLIP-seq
MIRT2617535	hsa-miR-320b	CLIP-seq
MIRT2617536	hsa-miR-320c	CLIP-seq
MIRT2617537	hsa-miR-320d	CLIP-seq
MIRT2617538	hsa-miR-323b-5p	CLIP-seq
MIRT2617539	hsa-miR-3673	CLIP-seq
MIRT2617540	hsa-miR-3689d	CLIP-seq
MIRT1326591	hsa-miR-3907	CLIP-seq
MIRT2617541	hsa-miR-4251	CLIP-seq
MIRT2321277	hsa-miR-4252	CLIP-seq
MIRT1326592	hsa-miR-4259	CLIP-seq
MIRT2617543	hsa-miR-4329	CLIP-seq
MIRT2321278	hsa-miR-4425	CLIP-seq
MIRT2617545	hsa-miR-4429	CLIP-seq
MIRT2617546	hsa-miR-4490	CLIP-seq
MIRT1326594	hsa-miR-4506	CLIP-seq
MIRT1326595	hsa-miR-451b	CLIP-seq
MIRT2617547	hsa-miR-4522	CLIP-seq
MIRT2617548	hsa-miR-4715-3p	CLIP-seq
MIRT1326596	hsa-miR-4795-3p	CLIP-seq
MIRT2617549	hsa-miR-4799-5p	CLIP-seq
MIRT2617550	hsa-miR-4802-5p	CLIP-seq
MIRT2617551	hsa-miR-515-5p	CLIP-seq
MIRT2321279	hsa-miR-607	CLIP-seq
MIRT2617552	hsa-miR-613	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
PPARD	Activation	14506281
PPARG	Activation	14506281
PPARG	Unknown	14750214

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEP	11866539
GO:0004145	Function	Diamine N-acetyltransferase activity	IBA	21873635
GO:0004145	Function	Diamine N-acetyltransferase activity	IDA	15283699
GO:0004145	Function	Diamine N-acetyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	16169070, 16189514, 19060904, 21516116, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005829	Component	Cytosol	IBA	21873635
GO:0005829	Component	Cytosol	TAS
GO:0006596	Process	Polyamine biosynthetic process	IDA	15283699
GO:0006596	Process	Polyamine biosynthetic process	TAS
GO:0008080	Function	N-acetyltransferase activity	IBA	21873635
GO:0008080	Function	N-acetyltransferase activity	IDA	15283699
GO:0009447	Process	Putrescine catabolic process	IEA
GO:0019809	Function	Spermidine binding	IBA	21873635
GO:0032918	Process	Spermidine acetylation	IBA	21873635
GO:0032918	Process	Spermidine acetylation	IDA	15283699
GO:0042802	Function	Identical protein binding	IPI	16189514, 16455797, 25416956

MIM	HGNC	e!Ensembl
313020	10540	ENSG00000130066

Protein

UniProt ID

P21673

Protein name

Diamine acetyltransferase 1 (EC 2.3.1.57) (Polyamine N-acetyltransferase 1) (Putrescine acetyltransferase) (Spermidine/spermine N(1)-acetyltransferase 1) (SSAT) (SSAT-1)

Protein function

Enzyme which catalyzes the acetylation of polyamines (PubMed:15283699, PubMed:16455797, PubMed:17516632). Substrate specificity: norspermidine = spermidine >> spermine > N(1)-acetylspermine (PubMed:17516632). This highly regulated enzyme allows

PDB

2B3U , 2B3V , 2B4B , 2B4D , 2B58 , 2B5G , 2F5I , 2FXF , 2G3T , 2JEV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00583	Acetyltransf_1	14 → 145	Acetyltransferase (GNAT) family	Family

Sequence

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVP
KEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRC
RCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE

Sequence length

171

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism Metabolic pathways Ferroptosis		Interconversion of polyamines

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	17374397
Obesity	Obesity	rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562 View all (27 more)	20882379

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Depressive disorder, Unipolar Depression, Major Depressive Disorder		19152344, 19851986	ClinVar

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	35569444
Anhedonia	Associate	21152090
Anxiety	Associate	21152090
Anxiety Disorders	Associate	21152090
Apraxias	Associate	23958961
Bipolar Disorder	Associate	23768751, 23958961
Brain Neoplasms	Stimulate	31399646
Breast Neoplasms	Associate	16207710
Burkitt Lymphoma	Inhibit	23891576
Calcinosis Cutis	Stimulate	25893668
Cap Myopathy	Associate	18974881
Carcinogenesis	Inhibit	16262603
Carcinoma	Associate	1652956
Carcinoma Hepatocellular	Associate	27901475, 35841206
Carcinoma Non Small Cell Lung	Associate	12697027, 16757480, 8573111
Carcinoma Squamous Cell	Associate	36247089
Cardiomyopathies	Associate	37872948
Colorectal Neoplasms	Stimulate	14506281
Colorectal Neoplasms	Associate	16262603, 16854216, 27901475
COVID 19	Associate	33138195
Diabetes Mellitus	Associate	18541544
Drug Related Side Effects and Adverse Reactions	Associate	1417826, 2241897, 8573111
Glioblastoma	Associate	22179681
Hypoxia Brain	Stimulate	26572277
Inflammation	Stimulate	16757480
Inflammation	Associate	28809398
Lichen Planus Oral	Associate	23892499, 39516476
Liver Diseases	Associate	23377783
Lung Diseases	Associate	26572277
Lung Neoplasms	Associate	37759783, 38513095, 8573111
Lymphoblastic Transformation Inhibition of	Stimulate	15096507
Lymphoma Non Hodgkin	Associate	35227235
Mental Disorders	Associate	27229768
Mood Disorders	Associate	21152090
Mouth Neoplasms	Associate	23892499
Muscular Dystrophy Duchenne	Associate	24190443, 25338682
Neoplasm Metastasis	Associate	25893668, 27901475
Neoplasms	Associate	12697027, 1417826, 22354986, 30214636, 31399646, 35227235
Neoplasms	Stimulate	16854216, 27411053
Neoplasms	Inhibit	27901475
Obesity	Associate	22354986
Pancreatitis	Associate	36671463
Parkinson Disease	Associate	36174040
Prostatic Neoplasms	Associate	20460526, 24647988, 25893668
Psychotic Disorders	Associate	23958961
Pterygium	Associate	19956562
Small Cell Lung Carcinoma	Associate	12697027, 2241897
Squamous Cell Carcinoma of Head and Neck	Associate	28861772, 39516476
Urinary Bladder Neoplasms	Associate	30214636
Urinary Tract Infections	Associate	30391630

SAT1 (spermidine/spermine N1-acetyltransferase 1)