Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	6300
Gene name	Mitogen-activated protein kinase 12
Gene symbol	MAPK12
Synonyms (NCBI Gene)	ERK-6ERK3ERK6MAPK 12P38GAMMAPRKM12SAPK-3SAPK3
Chromosome	22
Chromosome location	22q13.33
Summary	Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT2267114	hsa-miR-1226	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2267115	hsa-miR-4267	CLIP-seq
MIRT2267116	hsa-miR-4758-3p	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453712	hsa-miR-125a-3p	CLIP-seq
MIRT2453713	hsa-miR-1266	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453715	hsa-miR-3190	CLIP-seq
MIRT2453716	hsa-miR-3202	CLIP-seq
MIRT2453717	hsa-miR-3664-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453719	hsa-miR-3934	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453723	hsa-miR-4518	CLIP-seq
MIRT2453724	hsa-miR-4533	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453728	hsa-miR-493	CLIP-seq
MIRT2453729	hsa-miR-764	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IDA	15850461
GO:0000165	Process	MAPK cascade	IEA
GO:0000165	Process	MAPK cascade	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10508788
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8633070, 15850461
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	18221368
GO:0004707	Function	MAP kinase activity	IEA
GO:0004707	Function	MAP kinase activity	TAS	10848581
GO:0005515	Function	Protein binding	IPI	12761180, 15158451, 19294699, 24550280, 25158884, 25241761, 25416956, 30126976, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	TAS	8633070
GO:0007517	Process	Muscle organ development	TAS	8633070
GO:0016301	Function	Kinase activity	IEA
GO:0016504	Function	Peptidase activator activity	NAS	18221368
GO:0016740	Function	Transferase activity	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042770	Process	Signal transduction in response to DNA damage	TAS	10848581
GO:0045445	Process	Myoblast differentiation	IDA	8633070
GO:0045786	Process	Negative regulation of cell cycle	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS
GO:0051726	Process	Regulation of cell cycle	TAS	10848581
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602399	6874	ENSG00000188130

P53778

Protein name

Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK12 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

1CM8 , 4QUM , 6UNA , 7CGA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	27 → 311	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11991731, ECO:0000269|PubMed:8633070}.

Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Rap1 signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Oocyte meiosis Efferocytosis Cellular senescence Adrenergic signaling in cardiomyocytes VEGF signaling pathway Osteoclast differentiation Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Leukocyte transendothelial migration Thermogenesis Neurotrophin signaling pathway Retrograde endocannabinoid signaling Dopaminergic synapse Inflammatory mediator regulation of TRP channels GnRH signaling pathway Progesterone-mediated oocyte maturation Prolactin signaling pathway Relaxin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway DSCAM interactions VEGFA-VEGFR2 Pathway Myogenesis

MAPK12 (mitogen-activated protein kinase 12)