Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6300
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK12
Synonyms (NCBI Gene) Gene synonyms aliases	ERK-6, ERK3, ERK6, MAPK 12, P38GAMMA, PRKM12, SAPK-3, SAPK3
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Show/Hide all(62)

miRTarBase ID	miRNA	Experiments
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT1551126	hsa-miR-1203	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT1551127	hsa-miR-4715-3p	CLIP-seq
MIRT1551128	hsa-miR-4756-3p	CLIP-seq
MIRT2267114	hsa-miR-1226	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2267115	hsa-miR-4267	CLIP-seq
MIRT2267116	hsa-miR-4758-3p	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453712	hsa-miR-125a-3p	CLIP-seq
MIRT2453713	hsa-miR-1266	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453715	hsa-miR-3190	CLIP-seq
MIRT2453716	hsa-miR-3202	CLIP-seq
MIRT2453717	hsa-miR-3664-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453719	hsa-miR-3934	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453723	hsa-miR-4518	CLIP-seq
MIRT2453724	hsa-miR-4533	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453728	hsa-miR-493	CLIP-seq
MIRT2453729	hsa-miR-764	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq
MIRT2453711	hsa-miR-1207-5p	CLIP-seq
MIRT2453714	hsa-miR-24	CLIP-seq
MIRT2037039	hsa-miR-3667-3p	CLIP-seq
MIRT2453718	hsa-miR-3922-5p	CLIP-seq
MIRT2453720	hsa-miR-4257	CLIP-seq
MIRT2453721	hsa-miR-4437	CLIP-seq
MIRT2453722	hsa-miR-4514	CLIP-seq
MIRT2453725	hsa-miR-4690-5p	CLIP-seq
MIRT2453726	hsa-miR-4692	CLIP-seq
MIRT2453727	hsa-miR-4763-3p	CLIP-seq
MIRT2453730	hsa-miR-940	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000287	Function	Magnesium ion binding	IDA	10508788
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8633070, 15850461
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	18221368
GO:0004707	Function	MAP kinase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	12761180, 15158451, 19294699, 24550280, 25158884, 25241761, 25416956, 30126976, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006975	Process	DNA damage induced protein phosphorylation	TAS	10848581
GO:0007050	Process	Cell cycle arrest	TAS	10848581
GO:0007165	Process	Signal transduction	TAS	8633070
GO:0007517	Process	Muscle organ development	TAS	8633070
GO:0010952	Process	Positive regulation of peptidase activity	NAS	18221368
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	15850461
GO:0018105	Process	Peptidyl-serine phosphorylation	TAS	18221368
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0045445	Process	Myoblast differentiation	IDA	8633070
GO:0051149	Process	Positive regulation of muscle cell differentiation	TAS

MIM	HGNC	e!Ensembl
602399	6874	ENSG00000188130

Protein

UniProt ID

P53778

Protein name

Mitogen-activated protein kinase 12 (MAP kinase 12) (MAPK 12) (EC 2.7.11.24) (Extracellular signal-regulated kinase 6) (ERK-6) (Mitogen-activated protein kinase p38 gamma) (MAP kinase p38 gamma) (Stress-activated protein kinase 3)

Protein function

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK12 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli su

PDB

1CM8 , 4QUM , 6UNA , 7CGA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	27 → 311	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in skeletal muscle and heart. {ECO:0000269|PubMed:11991731, ECO:0000269|PubMed:8633070}.

Sequence

MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR
VSKETPL

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance MAPK signaling pathway Rap1 signaling pathway FoxO signaling pathway Sphingolipid signaling pathway Oocyte meiosis Efferocytosis Cellular senescence Adrenergic signaling in cardiomyocytes VEGF signaling pathway Osteoclast differentiation Signaling pathways regulating pluripotency of stem cells Platelet activation Neutrophil extracellular trap formation Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway Fc epsilon RI signaling pathway TNF signaling pathway Leukocyte transendothelial migration Thermogenesis Neurotrophin signaling pathway Retrograde endocannabinoid signaling Dopaminergic synapse Inflammatory mediator regulation of TRP channels GnRH signaling pathway Progesterone-mediated oocyte maturation Prolactin signaling pathway Relaxin signaling pathway Non-alcoholic fatty liver disease AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Alcoholic liver disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Epithelial cell signaling in Helicobacter pylori infection Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Proteoglycans in cancer Chemical carcinogenesis - reactive oxygen species PD-L1 expression and PD-1 checkpoint pathway in cancer Diabetic cardiomyopathy Lipid and atherosclerosis Fluid shear stress and atherosclerosis		NOD1/2 Signaling Pathway DSCAM interactions VEGFA-VEGFR2 Pathway Myogenesis

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Text Mining Associations (15)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	16885352, 20649952, 21878638, 24993294, 36524361, 38214819
Carcinogenesis	Associate	38214819
Carcinoma Hepatocellular	Stimulate	12679910
Cholangiocarcinoma	Associate	39831920
Colorectal Neoplasms	Associate	20332238, 24962213
Drug Related Side Effects and Adverse Reactions	Associate	34455585
Glioma	Associate	23807566
Hypertrophy	Associate	16920889
Inflammation	Associate	14694199
Influenza Human	Associate	36148221
Lymphoma T Cell Cutaneous	Associate	34455585
Neoplasms	Associate	19251701, 20332238, 20649952, 23807566, 30251680, 35962343, 38214819
Neoplasms	Inhibit	21878638
Squamous Cell Carcinoma of Head and Neck	Associate	29747487
Triple Negative Breast Neoplasms	Associate	38214819

MAPK12 (mitogen-activated protein kinase 12)