ACSM3 (acyl-CoA synthetase medium chain family member 3)

Gene

• Entrez ID: 6296
• Gene name: Acyl-CoA synthetase medium chain family member 3
• Gene symbol: ACSM3
• Synonyms (NCBI Gene): SA, SAH
• Chromosome: 16
• Chromosome location: 16p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT763681	hsa-miR-23a	CLIP-seq
MIRT763682	hsa-miR-23b	CLIP-seq
MIRT763683	hsa-miR-23c	CLIP-seq
MIRT763684	hsa-miR-2681	CLIP-seq
MIRT763685	hsa-miR-3163	CLIP-seq
MIRT763686	hsa-miR-340	CLIP-seq
MIRT763687	hsa-miR-4263	CLIP-seq
MIRT763688	hsa-miR-5096	CLIP-seq
MIRT763689	hsa-miR-548a-5p	CLIP-seq
MIRT763690	hsa-miR-548ab	CLIP-seq
MIRT763691	hsa-miR-548ak	CLIP-seq
MIRT763692	hsa-miR-548b-5p	CLIP-seq
MIRT763693	hsa-miR-548c-3p	CLIP-seq
MIRT763694	hsa-miR-548c-5p	CLIP-seq
MIRT763695	hsa-miR-548d-5p	CLIP-seq
MIRT763696	hsa-miR-548h	CLIP-seq
MIRT763697	hsa-miR-548i	CLIP-seq
MIRT763698	hsa-miR-548j	CLIP-seq
MIRT763699	hsa-miR-548k	CLIP-seq
MIRT763700	hsa-miR-548l	CLIP-seq
MIRT763701	hsa-miR-548w	CLIP-seq
MIRT763702	hsa-miR-548y	CLIP-seq
MIRT763703	hsa-miR-559	CLIP-seq
MIRT763704	hsa-miR-576-5p	CLIP-seq
MIRT2166533	hsa-miR-494	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004321	Function	Fatty-acyl-CoA synthase activity	IBA	21873635
GO:0005524	Function	ATP binding	IEA
GO:0005739	Component	Mitochondrion	IDA	11772874
GO:0005759	Component	Mitochondrial matrix	IBA	21873635
GO:0006633	Process	Fatty acid biosynthetic process	IBA	21873635
GO:0006637	Process	Acyl-CoA metabolic process	IBA	21873635
GO:0008217	Process	Regulation of blood pressure	NAS	7907320
GO:0015645	Function	Fatty acid ligase activity	IBA	21873635
GO:0031956	Function	Medium-chain fatty acid-CoA ligase activity	IEA
GO:0042632	Process	Cholesterol homeostasis	NAS	15361761
GO:0046872	Function	Metal ion binding	IEA
GO:0047760	Function	Butyrate-CoA ligase activity	IDA	11772874
GO:0050218	Function	Propionate-CoA ligase activity	IEA

Other IDs

• MIM: 145505
• HGNC: 10522
• e!Ensembl: ENSG00000005187

Protein

• UniProt ID: Q53FZ2
• Protein name: Acyl-coenzyme A synthetase ACSM3, mitochondrial (EC 6.2.1.2) (Acyl-CoA synthetase medium-chain family member 3) (Butyrate--CoA ligase 3) (Butyryl-coenzyme A synthetase 3) (Middle-chain acyl-CoA synthetase 3) (Propionate--CoA ligase) (EC 6.2.1.17) (Protein
• Protein function: Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism (PubMed:11772874). Capable of activating medium-chain fatty acids with a preference for isobutyrate among fatty acids with 2-6 carbon
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	71 → 484	AMP-binding enzyme	Family
  PF13193	AMP-binding_C	492 → 572	AMP-binding enzyme C-terminal domain	Domain

• Sequence:

  MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNF
  AKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRG
  DRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPA
  VDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSG
  YPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFT
  HHLPRFEPTSILQTLSKYPITVFCSAPTVYRMLVQNDITSYKFKSLKHCVSAGEPITPDV
  TEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPSPAFDVKIVDVNGNVLPPG
  QEGDIGIQVLPNRPFGLFTHYVDNPSKTASTLRGNFYITGDRGYMDKDGYFWFVARADDV
  ILSSGYRIGPFEVENALNEHPSVAESAVVSSPDPIRGEVVKAFVVLNPDYKSHDQEQLIK
  EIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEWKTI

• Sequence length: 586

Pathways

KEGG:

Butanoate metabolism
Metabolic pathways

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19208208

Unknown
Disease term	Disease name	Evidence	References	Source
Schizophrenia	Schizophrenia			GWAS
Insomnia	Insomnia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Aortic Aneurysm Abdominal	Associate	31885770
Arthritis Rheumatoid	Associate	19248090, 24850148
Burkitt Lymphoma	Associate	16736499
Carcinoma Hepatocellular	Associate	35196258
Cerebral Infarction	Associate	26352407
Essential Hypertension	Associate	14567496
Fatigue	Associate	11092699
Glomerulonephritis IGA	Associate	12484505
Hypertension	Associate	14567496, 19262474
Hypertrophy Left Ventricular	Associate	25329069
Influenza Human	Associate	35815857
Kidney Diseases	Associate	12484505
Leukemia	Associate	11175813, 12444172
Lymphoma Non Hodgkin	Associate	1311213
Obesity	Associate	19262474
Ovarian Neoplasms	Associate	35031699
Overweight	Associate	14567496
Renal Insufficiency Chronic	Associate	26352407