S100B (S100 calcium binding protein B)

Gene

• Entrez ID: 6285
• Gene name: S100 calcium binding protein B
• Gene symbol: S100B
• Synonyms (NCBI Gene): NEF, S100, S100-B, S100beta
• Chromosome: 21
• Chromosome location: 21q22.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003735	hsa-miR-29a-3p	Luciferase reporter assay, qRT-PCR, Northern blot	19102781
MIRT003736	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR, Northern blot	19102781
MIRT731708	hsa-miR-296-5p	Luciferase reporter assay	27186401
MIRT731708	hsa-miR-296-5p	Luciferase reporter assay, qRT-PCR, Western blot	27186401
MIRT1324165	hsa-miR-1182	CLIP-seq
MIRT1324166	hsa-miR-1908	CLIP-seq
MIRT1324167	hsa-miR-3618	CLIP-seq
MIRT1324168	hsa-miR-602	CLIP-seq
MIRT1324169	hsa-miR-663	CLIP-seq
MIRT1324170	hsa-miR-887	CLIP-seq
MIRT2320440	hsa-miR-1305	CLIP-seq
MIRT2320441	hsa-miR-3133	CLIP-seq
MIRT2320442	hsa-miR-3671	CLIP-seq
MIRT2320443	hsa-miR-4519	CLIP-seq
MIRT2320444	hsa-miR-4773	CLIP-seq
MIRT2320445	hsa-miR-607	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HOXC11	Unknown	20145129
TP53	Activation	15178678

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	10913138
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	20950652
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	9519411
GO:0005509	Function	Calcium ion binding	TAS	8202493
GO:0005515	Function	Protein binding	IPI	3111527, 10913138, 16189514, 17660747, 17726019, 20591429, 21516116, 25416956, 26496610, 26871637, 27107012, 28514442, 29997244, 31515488, 31837246, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	ISS
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10913138
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10913138
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005929	Component	Cilium	IDA
GO:0007155	Process	Cell adhesion	IEA
GO:0007409	Process	Axonogenesis	TAS	8202493
GO:0007417	Process	Central nervous system development	TAS	8202493
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0007613	Process	Memory	IEA
GO:0008270	Function	Zinc ion binding	IDA	20950652
GO:0008270	Function	Zinc ion binding	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0036064	Component	Ciliary basal body	IDA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	9519411, 10913138, 17660747, 25416956, 26871637, 27107012, 32296183, 35914814
GO:0042803	Function	Protein homodimerization activity	IDA	10913138
GO:0042803	Function	Protein homodimerization activity	IPI	9519411
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	15033494
GO:0044548	Function	S100 protein binding	IBA
GO:0044548	Function	S100 protein binding	IPI	9519411, 10913138
GO:0045471	Process	Response to ethanol	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	ISS
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048306	Function	Calcium-dependent protein binding	IDA	10913138
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12118070, 15033494
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0050786	Function	RAGE receptor binding	IBA
GO:0050786	Function	RAGE receptor binding	IEA
GO:0050786	Function	RAGE receptor binding	IPI	15033494
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051597	Process	Response to methylmercury	IEA
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0072347	Process	Response to anesthetic	IEA
GO:0097490	Process	Sympathetic neuron projection extension	IEA
GO:0097490	Process	Sympathetic neuron projection extension	ISS
GO:1990138	Process	Neuron projection extension	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS
GO:2001015	Process	Negative regulation of skeletal muscle cell differentiation	IEA

Other IDs

• MIM: 176990
• HGNC: 10500
• e!Ensembl: ENSG00000160307

Protein

• UniProt ID: P04271
• Protein name: Protein S100-B (S-100 protein beta chain) (S-100 protein subunit beta) (S100 calcium-binding protein B)
• Protein function: Small zinc- and- and calcium-binding protein that is highly expressed in astrocytes and constitutes one of the most abundant soluble proteins in brain (PubMed:20950652, PubMed:6487634). Weakly binds calcium but binds zinc very tightly-distinct b
• PDB: 1MQ1, 1UWO, 2H61, 2M49, 2PRU, 3CZT, 3D0Y, 3D10, 3HCM, 4XYN, 5CSF, 5CSI, 5CSJ, 5CSN, 5D7F
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	4 → 46	S-100/ICaBP type calcium binding domain	Domain
  PF00036	EF-hand_1	53 → 81	EF hand	Domain

• Tissue specificity: TISSUE SPECIFICITY: Although predominant among the water-soluble brain proteins, S100 is also found in a variety of other tissues. {ECO:0000269|PubMed:2394738}.
• Sequence:

  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
  LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Sequence length: 92

Pathways

Reactome:

Nuclear signaling by ERBB4
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
Advanced glycosylation endproduct receptor signaling
TRAF6 mediated NF-kB activation

<