Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6281
Gene name	S100 calcium binding protein A10
Gene symbol	S100A10
Synonyms (NCBI Gene)	42CANX2LANX2LGCAL1LCLP11Ca[1]GP11P11p10
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

101

Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048454	hsa-miR-100-5p	CLASH	23622248
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323809	hsa-miR-1321	CLIP-seq
MIRT1323810	hsa-miR-21	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323812	hsa-miR-3126-3p	CLIP-seq
MIRT1323813	hsa-miR-3133	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323826	hsa-miR-4490	CLIP-seq
MIRT1323827	hsa-miR-4511	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323838	hsa-miR-4739	CLIP-seq
MIRT1323839	hsa-miR-4756-5p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323842	hsa-miR-4774-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323848	hsa-miR-590-5p	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT1	Activation	12645529

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IDA	23861394
GO:0005509	Function	Calcium ion binding	IBA
GO:0005515	Function	Protein binding	IPI	14699089, 23091277, 23415230, 23861394, 24457100, 26941067, 30021884, 31837246, 32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	3126079
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	3126079
GO:0006900	Process	Vesicle budding from membrane	IDA	23861394
GO:0008289	Function	Lipid binding	IDA	23861394
GO:0009986	Component	Cell surface	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	9836589
GO:0016363	Component	Nuclear matrix	NAS	23415230
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISO
GO:0042803	Function	Protein homodimerization activity	IDA	23091277
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23129259
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	12198146
GO:0045121	Component	Membrane raft	IDA	14699089
GO:0045921	Process	Positive regulation of exocytosis	NAS	22940583
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISO
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	23129259
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	23129259
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072659	Process	Protein localization to plasma membrane	IDA	12198146
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	23415230
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IPI	9886297, 23275167
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	23129259
GO:1905686	Process	Positive regulation of plasma membrane repair	NAS	22940583
GO:1990665	Component	AnxA2-p11 complex	IDA	23091277, 23861394

MIM	HGNC	e!Ensembl
114085	10487	ENSG00000197747

P60903

Protein name

Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)

Protein function

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

PDB

1A4P , 1BT6 , 4DRW , 4FTG , 4HRE , 4HRG , 4HRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	5 → 44	S-100/ICaBP type calcium binding domain	Domain

Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Salmonella infection		Dissolution of Fibrin Clot

S100A10 (S100 calcium binding protein A10)