Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6281
Gene name Gene Name - the full gene name approved by the HGNC.	S100 calcium binding protein A10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	S100A10
Synonyms (NCBI Gene) Gene synonyms aliases	42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048454	hsa-miR-100-5p	CLASH	23622248
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323809	hsa-miR-1321	CLIP-seq
MIRT1323810	hsa-miR-21	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323812	hsa-miR-3126-3p	CLIP-seq
MIRT1323813	hsa-miR-3133	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323826	hsa-miR-4490	CLIP-seq
MIRT1323827	hsa-miR-4511	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323838	hsa-miR-4739	CLIP-seq
MIRT1323839	hsa-miR-4756-5p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323842	hsa-miR-4774-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323848	hsa-miR-590-5p	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT1	Activation	12645529

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IDA	23861394
GO:0005509	Function	Calcium ion binding	IBA
GO:0005515	Function	Protein binding	IPI	14699089, 23091277, 23415230, 23861394, 24457100, 26941067, 30021884, 31837246, 32296183, 33961781
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IDA	3126079
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	3126079
GO:0006900	Process	Vesicle budding from membrane	IDA	23861394
GO:0008289	Function	Lipid binding	IDA	23861394
GO:0009986	Component	Cell surface	IEA
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	9836589
GO:0016363	Component	Nuclear matrix	NAS	23415230
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISO
GO:0042803	Function	Protein homodimerization activity	IDA	23091277
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23129259
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IPI	12198146
GO:0045121	Component	Membrane raft	IDA	14699089
GO:0045921	Process	Positive regulation of exocytosis	NAS	22940583
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISO
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	23129259
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	23129259
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072659	Process	Protein localization to plasma membrane	IDA	12198146
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	23415230
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IEA
GO:0098797	Component	Plasma membrane protein complex	IPI	9886297, 23275167
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	23129259
GO:1905686	Process	Positive regulation of plasma membrane repair	NAS	22940583
GO:1990665	Component	AnxA2-p11 complex	IDA	23091277, 23861394

MIM	HGNC	e!Ensembl
114085	10487	ENSG00000197747

Protein

UniProt ID

P60903

Protein name

Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)

Protein function

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

PDB

1A4P , 1BT6 , 4DRW , 4FTG , 4HRE , 4HRG , 4HRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	5 → 44	S-100/ICaBP type calcium binding domain	Domain

Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Salmonella infection		Dissolution of Fibrin Clot

S100A10 (S100 calcium binding protein A10)