Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6281
Gene name Gene Name - the full gene name approved by the HGNC.	S100 calcium binding protein A10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	S100A10
Synonyms (NCBI Gene) Gene synonyms aliases	42C, ANX2L, ANX2LG, CAL1L, CLP11, Ca[1], GP11, P11, p10
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048454	hsa-miR-100-5p	CLASH	23622248
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323809	hsa-miR-1321	CLIP-seq
MIRT1323810	hsa-miR-21	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323812	hsa-miR-3126-3p	CLIP-seq
MIRT1323813	hsa-miR-3133	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323826	hsa-miR-4490	CLIP-seq
MIRT1323827	hsa-miR-4511	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323838	hsa-miR-4739	CLIP-seq
MIRT1323839	hsa-miR-4756-5p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323842	hsa-miR-4774-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323848	hsa-miR-590-5p	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323804	hsa-miR-105	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323807	hsa-miR-1275	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323814	hsa-miR-3151	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323816	hsa-miR-3616-3p	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323819	hsa-miR-4270	CLIP-seq
MIRT1323820	hsa-miR-4271	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323822	hsa-miR-4441	CLIP-seq
MIRT1323823	hsa-miR-4447	CLIP-seq
MIRT1323824	hsa-miR-4461	CLIP-seq
MIRT1323825	hsa-miR-4472	CLIP-seq
MIRT1323828	hsa-miR-4525	CLIP-seq
MIRT1323829	hsa-miR-4639-5p	CLIP-seq
MIRT1323830	hsa-miR-4665-5p	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323832	hsa-miR-4686	CLIP-seq
MIRT1323833	hsa-miR-4693-3p	CLIP-seq
MIRT1323834	hsa-miR-4712-3p	CLIP-seq
MIRT1323835	hsa-miR-4721	CLIP-seq
MIRT1323836	hsa-miR-4723-5p	CLIP-seq
MIRT1323837	hsa-miR-4725-3p	CLIP-seq
MIRT1323840	hsa-miR-4760-5p	CLIP-seq
MIRT1323841	hsa-miR-4768-5p	CLIP-seq
MIRT1323843	hsa-miR-486-3p	CLIP-seq
MIRT1323844	hsa-miR-491-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323846	hsa-miR-548c-3p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323849	hsa-miR-595	CLIP-seq
MIRT1323850	hsa-miR-625	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq
MIRT1323808	hsa-miR-1302	CLIP-seq
MIRT1323811	hsa-miR-3122	CLIP-seq
MIRT1323815	hsa-miR-361-5p	CLIP-seq
MIRT1323818	hsa-miR-3913-5p	CLIP-seq
MIRT1323821	hsa-miR-4298	CLIP-seq
MIRT1323831	hsa-miR-4670-5p	CLIP-seq
MIRT1323847	hsa-miR-549	CLIP-seq
MIRT1323805	hsa-miR-1237	CLIP-seq
MIRT1323806	hsa-miR-1248	CLIP-seq
MIRT1323817	hsa-miR-3675-5p	CLIP-seq
MIRT1323845	hsa-miR-500a	CLIP-seq
MIRT1323851	hsa-miR-767-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
STAT1	Activation	12645529

Show/Hide all(25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001765	Process	Membrane raft assembly	IDA	23861394
GO:0005509	Function	Calcium ion binding	IBA	21873635
GO:0005515	Function	Protein binding	IPI	14699089, 23091277, 23415230, 23861394, 24457100, 26941067, 30021884, 31837246, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0006900	Process	Vesicle budding from membrane	IDA	23861394
GO:0008289	Function	Lipid binding	IDA	23861394
GO:0019897	Component	Extrinsic component of plasma membrane	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	23091277
GO:0043547	Process	Positive regulation of GTPase activity	IMP	23129259
GO:0044325	Function	Ion channel binding	IBA	21873635
GO:0044325	Function	Ion channel binding	IPI	12198146
GO:0045121	Component	Membrane raft	IDA	14699089
GO:0048306	Function	Calcium-dependent protein binding	IBA	21873635
GO:0051099	Process	Positive regulation of binding	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	23129259
GO:0051894	Process	Positive regulation of focal adhesion assembly	IMP	23129259
GO:0062023	Component	Collagen-containing extracellular matrix	HDA	28675934
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072659	Process	Protein localization to plasma membrane	IDA	12198146
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	23129259
GO:1990665	Component	AnxA2-p11 complex	IDA	23091277, 23861394

MIM	HGNC	e!Ensembl
114085	10487	ENSG00000197747

Protein

UniProt ID

P60903

Protein name

Protein S100-A10 (Calpactin I light chain) (Calpactin-1 light chain) (Cellular ligand of annexin II) (S100 calcium-binding protein A10) (p10 protein) (p11)

Protein function

Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.

PDB

1A4P , 1BT6 , 4DRW , 4FTG , 4HRE , 4HRG , 4HRH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	5 → 44	S-100/ICaBP type calcium binding domain	Domain

Sequence

MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Salmonella infection		Dissolution of Fibrin Clot

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2)	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	17330099
Medulloblastoma	Medulloblastoma, Childhood Medulloblastoma, Adult Medulloblastoma, Desmoplastic Medulloblastoma, Melanotic medulloblastoma	rs1589970134, rs587776578, rs587776579, rs17847577, rs111033171, rs80359604, rs80358785, rs80358814, rs863224925, rs1555950011, rs1554231278, rs926177767, rs759412460, rs1564032829, rs761911009	17579622

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Endogenous depression, Depressive disorder, Major depression, single episode, Unipolar Depression, Depressive Syndrome, Depression, Neurotic, Major Depressive Disorder		24620999, 21682946, 21722919, 21367534, 20863517, 20962330	ClinVar

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	26838226, 35437508
Adenoma	Inhibit	25880590
Alzheimer Disease	Stimulate	35016256
Brain Damage Chronic	Associate	37063869
Breast Neoplasms	Stimulate	21153724
Carcinogenesis	Associate	23828264
Carcinoma	Associate	17695432
Carcinoma Hepatocellular	Associate	23598417, 32191631, 33546025, 36456877
Carcinoma Hepatocellular	Stimulate	36631249
Carcinoma Pancreatic Ductal	Associate	30009399
Carcinoma Papillary	Associate	17695432
Carcinoma Renal Cell	Associate	17083565
Carcinoma Squamous Cell	Associate	21897749
Colorectal Neoplasms	Associate	14570893, 23828264, 33160379, 33294444
COVID 19	Stimulate	35217896
COVID 19	Associate	37063869
Depressive Disorder	Associate	17241856, 34356598
Depressive Disorder	Inhibit	28137881
Depressive Disorder Major	Associate	24620999
Diarrhea	Associate	28458330
Endometrial Neoplasms	Associate	33931666
Essential Hypertension	Associate	40118787
Giant Cell Tumor of Tendon Sheath	Associate	24604026
Glioma	Associate	35779750
Hemorrhage	Associate	21310922
HIV Infections	Associate	9421482
Hyperaldosteronism	Associate	34690553
Hypertension	Associate	40118787
Inflammation	Associate	35217896, 35779750
Irritable Bowel Syndrome	Stimulate	17241856
Irritable Bowel Syndrome	Associate	28458330
Leukemia Myeloid Acute	Associate	29725008
Leukemia Promyelocytic Acute	Associate	21310922
Lung Neoplasms	Associate	21372205
Lupus Erythematosus Systemic	Associate	31536674
Lymphatic Metastasis	Associate	33931666
Lymphoma	Inhibit	12716467
Lymphoma Large B Cell Diffuse	Associate	12716467
Lymphoma Large Cell Anaplastic	Associate	16351635
Lymphoma Non Hodgkin	Associate	34148033
Medulloblastoma	Associate	17579622, 18664619
Melanoma	Associate	30216200
Neoplasm Metastasis	Associate	17695432, 26838226
Neoplasm Metastasis	Stimulate	35579448, 36631249
Neoplasms	Associate	12716467, 14570893, 17083565, 17695432, 18664619, 21372205, 21558493, 23828264, 26838226, 33160379, 35579448, 39272096
Osteoarthritis	Associate	24905701
Osteosarcoma	Associate	35579448
Ovarian Neoplasms	Associate	30558666, 30621740, 33217795
Pancreatic Neoplasms	Associate	30009399, 33580614
Parkinson Disease	Inhibit	28137881
Paroxysmal nonkinesigenic dyskinesia	Associate	33160379
Polycystic Kidney Autosomal Dominant	Associate	2345427
Squamous Cell Carcinoma of Head and Neck	Inhibit	18254958
Stomach Neoplasms	Stimulate	18793447
Thyroid Neoplasms	Associate	17695432

S100A10 (S100 calcium binding protein A10)