Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6280
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A9
Synonyms (NCBI Gene) Gene synonyms aliases
60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14, S100-A9
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000220 hsa-miR-196a-5p Review 20026422
MIRT003352 hsa-miR-196b-5p Review 20026422
MIRT000220 hsa-miR-196a-5p Luciferase reporter assay, qRT-PCR 19342367
MIRT710087 hsa-miR-132-5p HITS-CLIP 19536157
MIRT710086 hsa-miR-1204 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
CEBPA Activation 9706399
CEBPB Activation 9706399
GLI1 Unknown 16880536
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002523 Process Leukocyte migration involved in inflammatory response IBA
GO:0002523 Process Leukocyte migration involved in inflammatory response IDA 12626582
GO:0002544 Process Chronic inflammatory response IBA
GO:0005509 Function Calcium ion binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
123886 10499 ENSG00000163220
Protein
UniProt ID P06702
Protein name Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein function S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, Pub
PDB 1IRJ , 1XK4 , 4GGF , 4XJK , 5I8N , 5W1F , 6DS2 , 7QUV , 7UI5 , 8SJB , 8SJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 8 50 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Sequence length 114
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  IL-17 signaling pathway   RHO GTPases Activate NADPH Oxidases
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Metal sequestration by antimicrobial proteins
<