Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	6280
Gene name	S100 calcium binding protein A9
Gene symbol	S100A9
Synonyms (NCBI Gene)	60B8AGCAGBCFAGCGLBL1AGLIAGMAC387MIFMRP14NIFP14S100-A9
Chromosome	1
Chromosome location	1q21.3
Summary	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000220	hsa-miR-196a-5p	Review	20026422
MIRT003352	hsa-miR-196b-5p	Review	20026422
MIRT000220	hsa-miR-196a-5p	Luciferase reporter assayqRT-PCR	19342367
MIRT710087	hsa-miR-132-5p	HITS-CLIP	19536157
MIRT710086	hsa-miR-1204	HITS-CLIP	19536157
MIRT710085	hsa-miR-4679	HITS-CLIP	19536157
MIRT710084	hsa-miR-4252	HITS-CLIP	19536157
MIRT710083	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT710082	hsa-miR-588	HITS-CLIP	19536157
MIRT710087	hsa-miR-132-5p	HITS-CLIP	19536157
MIRT710086	hsa-miR-1204	HITS-CLIP	19536157
MIRT710085	hsa-miR-4679	HITS-CLIP	19536157
MIRT710084	hsa-miR-4252	HITS-CLIP	19536157
MIRT710083	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT710082	hsa-miR-588	HITS-CLIP	19536157
MIRT2393979	hsa-miR-3187-3p	CLIP-seq
MIRT2393980	hsa-miR-4318	CLIP-seq
MIRT2393981	hsa-miR-4435	CLIP-seq
MIRT2393982	hsa-miR-548s	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CEBPA	Activation	9706399
CEBPB	Activation	9706399
GLI1	Unknown	16880536

Show/Hide all (65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IBA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IDA	12626582
GO:0002544	Process	Chronic inflammatory response	IBA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	2149559, 22489132
GO:0005515	Function	Protein binding	IPI	9867828, 17620599, 20936779, 22808130, 24216507, 25417112, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	22489132
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12874352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	22489132
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	22489132
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	22489132
GO:0006914	Process	Autophagy	IDA	19935772
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	3313057
GO:0007267	Process	Cell-cell signaling	TAS	3313057
GO:0008017	Function	Microtubule binding	TAS	22489132
GO:0008270	Function	Zinc ion binding	TAS	22489132
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0014002	Process	Astrocyte development	IBA
GO:0016020	Component	Membrane	IEA
GO:0016209	Function	Antioxidant activity	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	22489132
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	12626582
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 28344315, 28675934
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	NAS	23123827, 25597447
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035425	Process	Autocrine signaling	IBA
GO:0035606	Process	Peptidyl-cysteine S-trans-nitrosylation	IDA	25417112
GO:0035662	Function	Toll-like receptor 4 binding	TAS	22489132
GO:0042742	Process	Defense response to bacterium	TAS	22489132
GO:0043542	Process	Endothelial cell migration	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050544	Function	Arachidonate binding	TAS	22489132
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12626582
GO:0050786	Function	RAGE receptor binding	TAS	22489132
GO:0050832	Process	Defense response to fungus	TAS	22489132
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	22489132
GO:0060264	Process	Regulation of respiratory burst involved in inflammatory response	NAS	23123827
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12874352
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070488	Process	Neutrophil aggregation	IBA
GO:0070488	Process	Neutrophil aggregation	IDA	12626582
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1990660	Component	Calprotectin complex	IPI	25597447
GO:1990660	Component	Calprotectin complex	ISO
GO:1990662	Component	S100A9 complex	IPI	11851337
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	19935772

MIM	HGNC	e!Ensembl
123886	10499	ENSG00000163220

P06702

Protein name

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Protein function

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, Pub

PDB

1IRJ , 1XK4 , 4GGF , 4XJK , 5I8N , 5W1F , 6DS2 , 7QUV , 7UI5 , 8SJB , 8SJC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	8 → 50	S-100/ICaBP type calcium binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr

Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Sequence length

114

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway		RHO GTPases Activate NADPH Oxidases Regulation of TLR by endogenous ligand Neutrophil degranulation Metal sequestration by antimicrobial proteins

S100A9 (S100 calcium binding protein A9)