S100A9 (S100 calcium binding protein A9)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6280
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A9
Synonyms (NCBI Gene) Gene synonyms aliases
60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14, S100-A9
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(19)
miRTarBase ID miRNA Experiments Reference
MIRT000220 hsa-miR-196a-5p Review 20026422
MIRT003352 hsa-miR-196b-5p Review 20026422
MIRT000220 hsa-miR-196a-5p Luciferase reporter assay, qRT-PCR 19342367
MIRT710087 hsa-miR-132-5p HITS-CLIP 19536157
MIRT710086 hsa-miR-1204 HITS-CLIP 19536157
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
CEBPA Activation 9706399
CEBPB Activation 9706399
GLI1 Unknown 16880536
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(65)
GO ID Ontology Definition Evidence Reference
GO:0001816 Process Cytokine production TAS 22489132
GO:0002224 Process Toll-like receptor signaling pathway TAS
GO:0002523 Process Leukocyte migration involved in inflammatory response IBA 21873635
GO:0002523 Process Leukocyte migration involved in inflammatory response IDA 12626582
GO:0002544 Process Chronic inflammatory response IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
123886 10499 ENSG00000163220
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P06702
Protein name Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein function S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, Pub
PDB 1IRJ , 1XK4 , 4GGF , 4XJK , 5I8N , 5W1F , 6DS2 , 7QUV , 7UI5 , 8SJB , 8SJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 8 → 50 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr
Sequence 
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Sequence length 114
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  IL-17 signaling pathway   RHO GTPases Activate NADPH Oxidases
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Metal sequestration by antimicrobial proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon, Colonic Neoplasms rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 15059925
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 15645418
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Celiac disease Celiac Disease 30097691 ClinVar
Show/Hide Text Mining Associations (261)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 21592353
Acute Disease Associate 32362107
Acute Kidney Injury Associate 33863396
Acute On Chronic Liver Failure Stimulate 37469934
Adenocarcinoma Stimulate 22588153
Adenolymphoma Associate 24205396
Adenoma Associate 33466593
Adenomatous Polyposis Coli Associate 33466593
Allergic Fungal Sinusitis Inhibit 18588753, 26266960
Allergic Fungal Sinusitis Associate 33005006