Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6280
Gene name Gene Name - the full gene name approved by the HGNC.	S100 calcium binding protein A9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	S100A9
Synonyms (NCBI Gene) Gene synonyms aliases	60B8AG, CAGB, CFAG, CGLB, L1AG, LIAG, MAC387, MIF, MRP14, NIF, P14, S100-A9
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000220	hsa-miR-196a-5p	Review	20026422
MIRT003352	hsa-miR-196b-5p	Review	20026422
MIRT000220	hsa-miR-196a-5p	Luciferase reporter assay, qRT-PCR	19342367
MIRT710087	hsa-miR-132-5p	HITS-CLIP	19536157
MIRT710086	hsa-miR-1204	HITS-CLIP	19536157
MIRT710085	hsa-miR-4679	HITS-CLIP	19536157
MIRT710084	hsa-miR-4252	HITS-CLIP	19536157
MIRT710083	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT710082	hsa-miR-588	HITS-CLIP	19536157
MIRT710087	hsa-miR-132-5p	HITS-CLIP	19536157
MIRT710086	hsa-miR-1204	HITS-CLIP	19536157
MIRT710085	hsa-miR-4679	HITS-CLIP	19536157
MIRT710084	hsa-miR-4252	HITS-CLIP	19536157
MIRT710083	hsa-miR-4701-5p	HITS-CLIP	19536157
MIRT710082	hsa-miR-588	HITS-CLIP	19536157
MIRT2393979	hsa-miR-3187-3p	CLIP-seq
MIRT2393980	hsa-miR-4318	CLIP-seq
MIRT2393981	hsa-miR-4435	CLIP-seq
MIRT2393982	hsa-miR-548s	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CEBPA	Activation	9706399
CEBPB	Activation	9706399
GLI1	Unknown	16880536

Show/Hide all(65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IBA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IDA	12626582
GO:0002544	Process	Chronic inflammatory response	IBA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	2149559, 22489132
GO:0005515	Function	Protein binding	IPI	9867828, 17620599, 20936779, 22808130, 24216507, 25417112, 32296183
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	22489132
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12874352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	22489132
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	22489132
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	22489132
GO:0006914	Process	Autophagy	IDA	19935772
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	3313057
GO:0007267	Process	Cell-cell signaling	TAS	3313057
GO:0008017	Function	Microtubule binding	TAS	22489132
GO:0008270	Function	Zinc ion binding	TAS	22489132
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0014002	Process	Astrocyte development	IBA
GO:0016020	Component	Membrane	IEA
GO:0016209	Function	Antioxidant activity	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	22489132
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	12626582
GO:0031012	Component	Extracellular matrix	HDA	23979707, 25037231, 28344315, 28675934
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	NAS	23123827, 25597447
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035425	Process	Autocrine signaling	IBA
GO:0035606	Process	Peptidyl-cysteine S-trans-nitrosylation	IDA	25417112
GO:0035662	Function	Toll-like receptor 4 binding	TAS	22489132
GO:0042742	Process	Defense response to bacterium	TAS	22489132
GO:0043542	Process	Endothelial cell migration	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050544	Function	Arachidonate binding	TAS	22489132
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12626582
GO:0050786	Function	RAGE receptor binding	TAS	22489132
GO:0050832	Process	Defense response to fungus	TAS	22489132
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	22489132
GO:0060264	Process	Regulation of respiratory burst involved in inflammatory response	NAS	23123827
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IBA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12874352
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070488	Process	Neutrophil aggregation	IBA
GO:0070488	Process	Neutrophil aggregation	IDA	12626582
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1990660	Component	Calprotectin complex	IPI	25597447
GO:1990660	Component	Calprotectin complex	ISO
GO:1990662	Component	S100A9 complex	IPI	11851337
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	19935772

MIM	HGNC	e!Ensembl
123886	10499	ENSG00000163220

Protein

UniProt ID

P06702

Protein name

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Protein function

S100A9 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response (PubMed:12626582, PubMed:15331440, PubMed:16258195, PubMed:19122197, PubMed:20103766, PubMed:21325622, Pub

PDB

1IRJ , 1XK4 , 4GGF , 4XJK , 5I8N , 5W1F , 6DS2 , 7QUV , 7UI5 , 8SJB , 8SJC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01023	S_100	8 → 50	S-100/ICaBP type calcium binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr

Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIE
HIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Sequence length

114

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway		RHO GTPases Activate NADPH Oxidases Regulation of TLR by endogenous ligand Neutrophil degranulation Metal sequestration by antimicrobial proteins

S100A9 (S100 calcium binding protein A9)