S100A8 (S100 calcium binding protein A8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6279
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A8
Synonyms (NCBI Gene) Gene synonyms aliases
60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8, S100-A8
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT027768 hsa-miR-98-5p Microarray 19088304
MIRT045918 hsa-miR-125b-5p CLASH 23622248
MIRT052953 hsa-miR-24-3p Luciferase reporter assay, Western blot 22139384
MIRT052953 hsa-miR-24-3p Luciferase reporter assay, Western blot 22139384
MIRT052953 hsa-miR-24-3p Luciferase reporter assay, Western blot 22139384
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(57)
GO ID Ontology Definition Evidence Reference
GO:0001816 Process Cytokine production TAS 22489132
GO:0002224 Process Toll-like receptor signaling pathway TAS
GO:0002523 Process Leukocyte migration involved in inflammatory response IBA 21873635
GO:0002523 Process Leukocyte migration involved in inflammatory response IDA 12626582
GO:0002526 Process Acute inflammatory response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
123885 10498 ENSG00000143546
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P05109
Protein name Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calcium-binding protein A8) (Urinary stone protein band A)
Protein function S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which h
PDB 1MR8 , 1XK4 , 4GGF , 4XJK , 5HLO , 5HLV , 5W1F , 6DS2 , 7QUV , 8SJB , 8SJC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 → 47 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr
Sequence 
MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
Sequence length 93
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  IL-17 signaling pathway   RHO GTPases Activate NADPH Oxidases
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Metal sequestration by antimicrobial proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Atopic, Contact Dermatitis rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 18336422, 25724174
Leukemia Leukemia, Myelocytic, Acute, Acute Myeloid Leukemia (AML-M2) rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 21971985
Show/Hide Text Mining Associations (263)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 23290504
Acute On Chronic Liver Failure Stimulate 37469934
Adenocarcinoma of Lung Associate 34659209
Adenoma Associate 17109495
Adenomatous Polyposis Coli Associate 33466593
Allergic Fungal Sinusitis Associate 18588753
Allergic Fungal Sinusitis Inhibit 20226301, 26266960
Alveolar Bone Loss Associate 35315933
Amyotrophic Lateral Sclerosis Associate 32792518
Anaphylaxis Stimulate 30189430