S100A8 (S100 calcium binding protein A8)

Gene

• Entrez ID: 6279
• Gene name: S100 calcium binding protein A8
• Gene symbol: S100A8
• Synonyms (NCBI Gene): 60B8AG, CAGA, CFAG, CGLA, CP-10, L1Ag, MA387, MIF, MRP8, NIF, P8, S100-A8
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT027768	hsa-miR-98-5p	Microarray	19088304
MIRT045918	hsa-miR-125b-5p	CLASH	23622248
MIRT052953	hsa-miR-24-3p	Luciferase reporter assay, Western blot	22139384
MIRT052953	hsa-miR-24-3p	Luciferase reporter assay, Western blot	22139384
MIRT052953	hsa-miR-24-3p	Luciferase reporter assay, Western blot	22139384
MIRT756457	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	36920714

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IBA
GO:0002523	Process	Leukocyte migration involved in inflammatory response	IDA	12626582
GO:0002544	Process	Chronic inflammatory response	IEA
GO:0002790	Process	Peptide secretion	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	TAS	2149559, 22489132
GO:0005515	Function	Protein binding	IPI	9867828, 20936779, 22808130, 25417112, 31837246
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	22489132
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005615	Component	Extracellular space	IEA
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS	22489132
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	TAS	22489132
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	22489132
GO:0006914	Process	Autophagy	IDA	19935772
GO:0006914	Process	Autophagy	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	3313057
GO:0008017	Function	Microtubule binding	TAS	22489132
GO:0008270	Function	Zinc ion binding	TAS	22489132
GO:0010043	Process	Response to zinc ion	IEA
GO:0014002	Process	Astrocyte development	IEA
GO:0016020	Component	Membrane	IEA
GO:0018119	Process	Peptidyl-cysteine S-nitrosylation	IMP	25417112
GO:0030307	Process	Positive regulation of cell growth	TAS	22489132
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	12626582
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28344315, 28675934
GO:0032496	Process	Response to lipopolysaccharide	IBA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	NAS	22489132, 25597447
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035425	Process	Autocrine signaling	IEA
GO:0035662	Function	Toll-like receptor 4 binding	TAS	22489132
GO:0042742	Process	Defense response to bacterium	TAS	22489132
GO:0043542	Process	Endothelial cell migration	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045471	Process	Response to ethanol	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050544	Function	Arachidonate binding	TAS	22489132
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12626582
GO:0050786	Function	RAGE receptor binding	TAS	22489132
GO:0050832	Process	Defense response to fungus	TAS	22489132
GO:0051493	Process	Regulation of cytoskeleton organization	TAS	22489132
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0070488	Process	Neutrophil aggregation	IBA
GO:0070488	Process	Neutrophil aggregation	IDA	12626582
GO:1990660	Component	Calprotectin complex	IPI	25597447
GO:1990660	Component	Calprotectin complex	ISO
GO:1990661	Component	S100A8 complex	IPI	27251136
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IDA	19935772

Other IDs

• MIM: 123885
• HGNC: 10498
• e!Ensembl: ENSG00000143546

Protein

• UniProt ID: P05109
• Protein name: Protein S100-A8 (Calgranulin-A) (Calprotectin L1L subunit) (Cystic fibrosis antigen) (CFAG) (Leukocyte L1 complex light chain) (Migration inhibitory factor-related protein 8) (MRP-8) (p8) (S100 calcium-binding protein A8) (Urinary stone protein band A)
• Protein function: S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which h
• PDB: 1MR8, 1XK4, 4GGF, 4XJK, 5HLO, 5HLV, 5W1F, 6DS2, 7QUV, 8SJB, 8SJC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 47	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Calprotectin (S100A8/9) is predominantly expressed in myeloid cells. Except for inflammatory conditions, the expression is restricted to a specific stage of myeloid differentiation since both proteins are expressed in circulating neutr
• Sequence:

  MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDI
  NTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

• Sequence length: 93

Pathways

KEGG:

IL-17 signaling pathway

Reactome:

RHO GTPases Activate NADPH Oxidases
Regulation of TLR by endogenous ligand
Neutrophil degranulation
Metal sequestration by antimicrobial proteins