Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6278
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A7
Synonyms (NCBI Gene) Gene synonyms aliases
PSOR1, S100A7c
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030103 hsa-miR-26b-5p Microarray 19088304
MIRT756458 hsa-miR-199a-5p Luciferase reporter assay, qRT-PCR 36920714
MIRT1324085 hsa-miR-1253 CLIP-seq
MIRT1324086 hsa-miR-3617 CLIP-seq
MIRT1324087 hsa-miR-4299 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
GLI1 Unknown 16880536
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000302 Process Response to reactive oxygen species IDA 16082188
GO:0001525 Process Angiogenesis NAS 16357139
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 8077703
GO:0005509 Function Calcium ion binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600353 10497 ENSG00000143556
Protein
UniProt ID P31151
Protein name Protein S100-A7 (Psoriasin) (S100 calcium-binding protein A7)
PDB 1PSR , 2PSR , 2WND , 2WOR , 2WOS , 3PSR , 4AQJ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 6 45 S-100/ICaBP type calcium binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients. {ECO:0000269|PubMed:8618345}.
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Sequence length 101
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  IL-17 signaling pathway   Neutrophil degranulation
Metal sequestration by antimicrobial proteins
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Obsessive-Compulsive Disorder Obsessive-compulsive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acne Vulgaris Associate 32685503
Adenocarcinoma Associate 21623236, 28177901
Adenocarcinoma of Lung Associate 21623236, 28177901, 36782138
Allergic Fungal Sinusitis Inhibit 18588753, 20226301
Alzheimer Disease Associate 23533003
Arthritis Psoriatic Associate 12839573, 17136347, 22402441, 25332209
Bowen's Disease Associate 36085041
Breast Neoplasms Associate 10595935, 12600274, 19136201, 19844956, 23618129, 28634007, 30137688, 32444848, 36598637
Breast Neoplasms Inhibit 18804527
Carcinogenesis Associate 12600274