S100A7 (S100 calcium binding protein A7)

Gene

• Entrez ID: 6278
• Gene name: S100 calcium binding protein A7
• Gene symbol: S100A7
• Synonyms (NCBI Gene): PSOR1, S100A7c
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030103	hsa-miR-26b-5p	Microarray	19088304
MIRT756458	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR	36920714
MIRT1324085	hsa-miR-1253	CLIP-seq
MIRT1324086	hsa-miR-3617	CLIP-seq
MIRT1324087	hsa-miR-4299	CLIP-seq
MIRT1324088	hsa-miR-4434	CLIP-seq
MIRT1324089	hsa-miR-4456	CLIP-seq
MIRT1324090	hsa-miR-4516	CLIP-seq
MIRT1324091	hsa-miR-541	CLIP-seq
MIRT1324092	hsa-miR-548q	CLIP-seq
MIRT1324093	hsa-miR-641	CLIP-seq
MIRT1324094	hsa-miR-654-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GLI1	Unknown	16880536

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IDA	16082188
GO:0001525	Process	Angiogenesis	NAS	16357139
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	8077703
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	12421467, 12839573, 32296183
GO:0005576	Component	Extracellular region	IDA	11782356, 15568027
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	9693957
GO:0005615	Component	Extracellular space	IDA	21805676
GO:0005634	Component	Nucleus	IDA	10595935
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10595935
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9693957
GO:0005783	Component	Endoplasmic reticulum	IDA	12839573
GO:0005829	Component	Cytosol	IDA	12839573
GO:0005925	Component	Focal adhesion	NAS	12839573
GO:0008270	Function	Zinc ion binding	NAS	10026247
GO:0008544	Process	Epidermis development	TAS	1940442
GO:0010820	Process	Positive regulation of T cell chemotaxis	IDA	18606705
GO:0030216	Process	Keratinocyte differentiation	NAS	15740587
GO:0031012	Component	Extracellular matrix	HDA	27068509
GO:0032496	Process	Response to lipopolysaccharide	IEP	17625598
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0043542	Process	Endothelial cell migration	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0046914	Function	Transition metal ion binding	IEA
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0050786	Function	RAGE receptor binding	IPI	18606705
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	15568027
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18606705
GO:0071624	Process	Positive regulation of granulocyte chemotaxis	IDA	18606705
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	18606705
GO:0140486	Function	Zinc ion sequestering activity	IDA	15568027

Other IDs

• MIM: 600353
• HGNC: 10497
• e!Ensembl: ENSG00000143556

Protein

• UniProt ID: P31151
• Protein name: Protein S100-A7 (Psoriasin) (S100 calcium-binding protein A7)
• PDB: 1PSR, 2PSR, 2WND, 2WOR, 2WOS, 3PSR, 4AQJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	6 → 45	S-100/ICaBP type calcium binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients. {ECO:0000269|PubMed:8618345}.
• Sequence:

  MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
  KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ

• Sequence length: 101

Pathways

KEGG:

IL-17 signaling pathway

Reactome:

Neutrophil degranulation
Metal sequestration by antimicrobial proteins