Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6277
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A6
Synonyms (NCBI Gene) Gene synonyms aliases
2A9, 5B10, CABP, CACY, PRA, S10A6
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT731072 hsa-miR-141-3p 5.0 25241899
MIRT731072 hsa-miR-141-3p 5.0 25241899
MIRT731072 hsa-miR-141-3p 5.0 25241899
MIRT731072 hsa-miR-141-3p 5.0 25241899
MIRT731072 hsa-miR-141-3p 5.0 25241899
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 12859951
NFKBIA Repression 12859951
RELA Activation 12859951
USF1 Activation 11118618
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001726 Component Ruffle IDA 10913138
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 11937060
GO:0005509 Function Calcium ion binding IEA
GO:0005509 Function Calcium ion binding NAS 12577318
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
114110 10496 ENSG00000197956
Protein
UniProt ID P06703
Protein name Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
Protein function May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the re
PDB 1K8U , 1K96 , 1K9K , 1K9P , 2M1K , 4YBH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 43 S-100/ICaBP type calcium binding domain Domain
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
DRNKDQEVNFQEYVTFLGALALIYNEALKG
Sequence length 90
Interactions View interactions
<