S100A6 (S100 calcium binding protein A6)

Gene

• Entrez ID: 6277
• Gene name: S100 calcium binding protein A6
• Gene symbol: S100A6
• Synonyms (NCBI Gene): 2A9, 5B10, CABP, CACY, PRA, S10A6
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT731072	hsa-miR-141-3p	5.0	25241899
MIRT1324075	hsa-miR-1243	CLIP-seq
MIRT1324076	hsa-miR-1290	CLIP-seq
MIRT1324077	hsa-miR-136	CLIP-seq
MIRT1324078	hsa-miR-3167	CLIP-seq
MIRT1324079	hsa-miR-361-3p	CLIP-seq
MIRT1324080	hsa-miR-3919	CLIP-seq
MIRT1324081	hsa-miR-4275	CLIP-seq
MIRT1324082	hsa-miR-4751	CLIP-seq
MIRT1324083	hsa-miR-4756-3p	CLIP-seq
MIRT1324084	hsa-miR-876-5p	CLIP-seq
MIRT1324075	hsa-miR-1243	CLIP-seq
MIRT1324076	hsa-miR-1290	CLIP-seq
MIRT1324078	hsa-miR-3167	CLIP-seq
MIRT1324079	hsa-miR-361-3p	CLIP-seq
MIRT1324080	hsa-miR-3919	CLIP-seq
MIRT1324082	hsa-miR-4751	CLIP-seq
MIRT1324083	hsa-miR-4756-3p	CLIP-seq
MIRT1324084	hsa-miR-876-5p	CLIP-seq
MIRT1324075	hsa-miR-1243	CLIP-seq
MIRT1324076	hsa-miR-1290	CLIP-seq
MIRT1324078	hsa-miR-3167	CLIP-seq
MIRT1324079	hsa-miR-361-3p	CLIP-seq
MIRT1324080	hsa-miR-3919	CLIP-seq
MIRT1324081	hsa-miR-4275	CLIP-seq
MIRT2096208	hsa-miR-4282	CLIP-seq
MIRT1324082	hsa-miR-4751	CLIP-seq
MIRT1324083	hsa-miR-4756-3p	CLIP-seq
MIRT1324084	hsa-miR-876-5p	CLIP-seq
MIRT1324075	hsa-miR-1243	CLIP-seq
MIRT1324076	hsa-miR-1290	CLIP-seq
MIRT1324077	hsa-miR-136	CLIP-seq
MIRT1324078	hsa-miR-3167	CLIP-seq
MIRT1324079	hsa-miR-361-3p	CLIP-seq
MIRT1324080	hsa-miR-3919	CLIP-seq
MIRT1324081	hsa-miR-4275	CLIP-seq
MIRT1324082	hsa-miR-4751	CLIP-seq
MIRT1324083	hsa-miR-4756-3p	CLIP-seq
MIRT1324084	hsa-miR-876-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	12859951
NFKBIA	Repression	12859951
RELA	Activation	12859951
USF1	Activation	11118618

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IDA	10913138
GO:0005509	Function	Calcium ion binding	IBA
GO:0005509	Function	Calcium ion binding	IDA	11937060
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	12577318
GO:0005515	Function	Protein binding	IPI	10913138, 12577318, 19724273, 20188096, 20591429, 20965181, 25416956, 28514442, 29997244, 31837246, 32296183, 33961781
GO:0005523	Function	Tropomyosin binding	IDA	19724273
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10913138
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	12601007, 12805373
GO:0005635	Component	Nuclear envelope	IEA
GO:0005635	Component	Nuclear envelope	NAS	12577318
GO:0005737	Component	Cytoplasm	IDA	10913138, 12601007
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA	19724273
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	TAS	16130169
GO:0007409	Process	Axonogenesis	NAS	12152788
GO:0008270	Function	Zinc ion binding	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	19724273
GO:0015075	Function	Monoatomic ion transmembrane transporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0031012	Component	Extracellular matrix	HDA	25037231, 28675934
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IDA	10913138
GO:0042803	Function	Protein homodimerization activity	IPI	11937060
GO:0044548	Function	S100 protein binding	IBA
GO:0044548	Function	S100 protein binding	IPI	10913138
GO:0046872	Function	Metal ion binding	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	NAS	12577318
GO:0048306	Function	Calcium-dependent protein binding	IBA
GO:0048306	Function	Calcium-dependent protein binding	IDA	10913138
GO:0048471	Component	Perinuclear region of cytoplasm	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12118070
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708

Other IDs

• MIM: 114110
• HGNC: 10496
• e!Ensembl: ENSG00000197956

Protein

• UniProt ID: P06703
• Protein name: Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
• Protein function: May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the re
• PDB: 1K8U, 1K96, 1K9K, 1K9P, 2M1K, 4YBH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01023	S_100	5 → 43	S-100/ICaBP type calcium binding domain	Domain

• Sequence:

  MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDL
  DRNKDQEVNFQEYVTFLGALALIYNEALKG

• Sequence length: 90