Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6276
Gene name Gene Name - the full gene name approved by the HGNC.
S100 calcium binding protein A5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
S100A5
Synonyms (NCBI Gene) Gene synonyms aliases
S100D
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017899 hsa-miR-335-5p Microarray 18185580
MIRT1324072 hsa-miR-3616-3p CLIP-seq
MIRT1324073 hsa-miR-4436b-3p CLIP-seq
MIRT1324074 hsa-miR-4710 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005507 Function Copper ion binding IDA 19536568
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 19536568
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 31837246
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
176991 10495 ENSG00000196420
Protein
UniProt ID P33763
Protein name Protein S100-A5 (Protein S-100D) (S100 calcium-binding protein A5)
Protein function Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
PDB 2KAX , 2KAY , 4DIR , 6WN7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 43 S-100/ICaBP type calcium binding domain Domain
Sequence
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLD
KNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Sequence length 92
Interactions View interactions
<