S100A5 (S100 calcium binding protein A5)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 6276
Gene name S100 calcium binding protein A5
Gene symbol S100A5
Synonyms (NCBI Gene)
S100D
Chromosome 1
Chromosome location 1q21.3
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
miRNA miRNA information provided by mirtarbase database.
4
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (4)
miRTarBase ID miRNA Experiments Reference
MIRT017899 hsa-miR-335-5p Microarray 18185580
MIRT1324072 hsa-miR-3616-3p CLIP-seq
MIRT1324073 hsa-miR-4436b-3p CLIP-seq
MIRT1324074 hsa-miR-4710 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (14)
GO ID Ontology Definition Evidence Reference
GO:0005507 Function Copper ion binding IDA 19536568
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IDA 19536568
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 31837246
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
176991 10495 ENSG00000196420
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P33763
Protein name Protein S100-A5 (Protein S-100D) (S100 calcium-binding protein A5)
Protein function Binds calcium, zinc and copper. One subunit can simultaneously bind 2 calcium ions or 2 copper ions plus 1 zinc ion. Calcium and copper ions compete for the same binding sites.
PDB 2KAX , 2KAY , 4DIR , 6WN7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01023 S_100 5 → 43 S-100/ICaBP type calcium binding domain Domain
Sequence 
METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLD
KNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK
Sequence length 92
Interactions View interactions