Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	627
Gene name Gene Name - the full gene name approved by the HGNC.	Brain derived neurotrophic factor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BDNF
Synonyms (NCBI Gene) Gene synonyms aliases	ANON2, BULN2
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p14.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding

Show/Hide all(135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001946	hsa-miR-30a-5p	Luciferase reporter assay	18632683
MIRT003153	hsa-miR-210-3p	2DGE, immunoprecipitaion, Luciferase reporter assay, Mass spectrometry, Microarray, qRT-PCR, Western blot	19826008
MIRT002955	hsa-miR-1-3p	Luciferase reporter assay	14697198
MIRT005900	hsa-miR-22-3p	Luciferase reporter assay, Microarray	21168126
MIRT054501	hsa-miR-182-5p	qRT-PCR, Western blotting	23704927
MIRT054502	hsa-miR-132-3p	qRT-PCR, Western blotting	23704927
MIRT437447	hsa-miR-204-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	23285024
MIRT437463	hsa-miR-16-5p	Luciferase reporter assay, qRT-PCR, Western blot	24026226
MIRT000362	hsa-miR-124-3p	LacZ reporter assay	23601049
MIRT438353	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT438353	hsa-miR-206	Flow, qRT-PCR	24855559
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT732282	hsa-miR-1-5p	Luciferase reporter assay, qRT-PCR, Western blot	27381812
MIRT054501	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	25955435
MIRT054501	hsa-miR-182-5p	Luciferase reporter assay, qRT-PCR	25955435
MIRT735361	hsa-miR-10a-5p	Luciferase reporter assay, qRT-PCR	28112253
MIRT437447	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25962115
MIRT003153	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	26708520
MIRT003153	hsa-miR-210-3p	Luciferase reporter assay, qRT-PCR, Western blot	26708520
MIRT438353	hsa-miR-206	Microarray	32041109
MIRT733089	hsa-miR-155-5p	Luciferase reporter assay, Western blotting, qRT-PCR	33511575
MIRT733831	hsa-miR-202-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32425535
MIRT735361	hsa-miR-10a-5p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR	32291635
MIRT755327	hsa-miR-134-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	38579169
MIRT437447	hsa-miR-204-5p	Western blotting, qRT-PCR	35158801
MIRT820502	hsa-miR-1827	CLIP-seq
MIRT820503	hsa-miR-2467-3p	CLIP-seq
MIRT820504	hsa-miR-4257	CLIP-seq
MIRT820505	hsa-miR-4316	CLIP-seq
MIRT820506	hsa-miR-4698	CLIP-seq
MIRT820507	hsa-miR-4710	CLIP-seq
MIRT820508	hsa-miR-940	CLIP-seq
MIRT820509	hsa-miR-147b	CLIP-seq
MIRT820510	hsa-miR-155	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT820512	hsa-miR-210	CLIP-seq
MIRT820513	hsa-miR-2861	CLIP-seq
MIRT820514	hsa-miR-3192	CLIP-seq
MIRT820515	hsa-miR-3617	CLIP-seq
MIRT820516	hsa-miR-365	CLIP-seq
MIRT820517	hsa-miR-3689a-3p	CLIP-seq
MIRT820518	hsa-miR-3689c	CLIP-seq
MIRT820519	hsa-miR-3689d	CLIP-seq
MIRT820520	hsa-miR-382	CLIP-seq
MIRT820521	hsa-miR-3940-5p	CLIP-seq
MIRT820522	hsa-miR-4314	CLIP-seq
MIRT820523	hsa-miR-4446-5p	CLIP-seq
MIRT820524	hsa-miR-4507	CLIP-seq
MIRT820525	hsa-miR-452	CLIP-seq
MIRT820526	hsa-miR-4676-3p	CLIP-seq
MIRT820527	hsa-miR-4728-5p	CLIP-seq
MIRT820528	hsa-miR-4755-5p	CLIP-seq
MIRT820529	hsa-miR-4781-5p	CLIP-seq
MIRT820530	hsa-miR-641	CLIP-seq
MIRT820531	hsa-miR-661	CLIP-seq
MIRT820532	hsa-miR-744	CLIP-seq
MIRT820533	hsa-miR-933	CLIP-seq
MIRT820534	hsa-miR-943	CLIP-seq
MIRT820535	hsa-miR-129-5p	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT820536	hsa-miR-3170	CLIP-seq
MIRT820515	hsa-miR-3617	CLIP-seq
MIRT820537	hsa-miR-3976	CLIP-seq
MIRT820538	hsa-miR-4260	CLIP-seq
MIRT820539	hsa-miR-4277	CLIP-seq
MIRT820540	hsa-miR-4307	CLIP-seq
MIRT820541	hsa-miR-579	CLIP-seq
MIRT820530	hsa-miR-641	CLIP-seq
MIRT820542	hsa-miR-889	CLIP-seq
MIRT1921408	hsa-miR-2355-5p	CLIP-seq
MIRT1921409	hsa-miR-3124-3p	CLIP-seq
MIRT1921410	hsa-miR-339-5p	CLIP-seq
MIRT1921411	hsa-miR-3675-3p	CLIP-seq
MIRT1921412	hsa-miR-3679-3p	CLIP-seq
MIRT1921413	hsa-miR-4648	CLIP-seq
MIRT1921414	hsa-miR-4654	CLIP-seq
MIRT1921415	hsa-miR-4684-5p	CLIP-seq
MIRT1921416	hsa-miR-4769-5p	CLIP-seq
MIRT1942471	hsa-miR-3120-3p	CLIP-seq
MIRT1942472	hsa-miR-583	CLIP-seq
MIRT820511	hsa-miR-2053	CLIP-seq
MIRT2181283	hsa-miR-3163	CLIP-seq
MIRT2181284	hsa-miR-4282	CLIP-seq
MIRT2181285	hsa-miR-4789-5p	CLIP-seq
MIRT2464905	hsa-miR-3922-5p	CLIP-seq
MIRT2464906	hsa-miR-3925-5p	CLIP-seq
MIRT820537	hsa-miR-3976	CLIP-seq
MIRT2464907	hsa-miR-4717-5p	CLIP-seq
MIRT2464908	hsa-miR-4753-5p	CLIP-seq
MIRT2484554	hsa-miR-3180-5p	CLIP-seq
MIRT2484555	hsa-miR-514	CLIP-seq
MIRT2484556	hsa-miR-514b-3p	CLIP-seq
MIRT2484557	hsa-miR-520a-5p	CLIP-seq
MIRT2484558	hsa-miR-525-5p	CLIP-seq
MIRT2484559	hsa-miR-616	CLIP-seq
MIRT2484560	hsa-miR-642b	CLIP-seq
MIRT2484561	hsa-miR-646	CLIP-seq
MIRT2675914	hsa-miR-125a-3p	CLIP-seq
MIRT2675915	hsa-miR-138	CLIP-seq
MIRT2675916	hsa-miR-140-3p	CLIP-seq
MIRT2675917	hsa-miR-1587	CLIP-seq
MIRT2675918	hsa-miR-203	CLIP-seq
MIRT2675919	hsa-miR-205	CLIP-seq
MIRT2675920	hsa-miR-3064-3p	CLIP-seq
MIRT1942471	hsa-miR-3120-3p	CLIP-seq
MIRT2675921	hsa-miR-3143	CLIP-seq
MIRT2675922	hsa-miR-3179	CLIP-seq
MIRT2484554	hsa-miR-3180-5p	CLIP-seq
MIRT2675923	hsa-miR-34c-3p	CLIP-seq
MIRT2675924	hsa-miR-3691-3p	CLIP-seq
MIRT2675925	hsa-miR-3934	CLIP-seq
MIRT820504	hsa-miR-4257	CLIP-seq
MIRT2675926	hsa-miR-4311	CLIP-seq
MIRT2675927	hsa-miR-4420	CLIP-seq
MIRT2675928	hsa-miR-4477b	CLIP-seq
MIRT2675929	hsa-miR-4492	CLIP-seq
MIRT2675930	hsa-miR-4498	CLIP-seq
MIRT2675931	hsa-miR-451b	CLIP-seq
MIRT2675932	hsa-miR-4643	CLIP-seq
MIRT2675933	hsa-miR-4656	CLIP-seq
MIRT2675934	hsa-miR-4675	CLIP-seq
MIRT2675935	hsa-miR-4696	CLIP-seq
MIRT2675936	hsa-miR-4741	CLIP-seq
MIRT2675937	hsa-miR-4786-5p	CLIP-seq
MIRT2675938	hsa-miR-4790-3p	CLIP-seq
MIRT2675939	hsa-miR-5096	CLIP-seq
MIRT2484557	hsa-miR-520a-5p	CLIP-seq
MIRT2484558	hsa-miR-525-5p	CLIP-seq
MIRT2675940	hsa-miR-543	CLIP-seq
MIRT2484559	hsa-miR-616	CLIP-seq
MIRT2484560	hsa-miR-642b	CLIP-seq
MIRT2675941	hsa-miR-762	CLIP-seq
MIRT2675942	hsa-miR-764	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CREB1	Activation	11719924
REST	Repression	18075316;18518926

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005163	Function	Nerve growth factor receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	7703225, 10631974, 25241761, 29997244, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	ISS
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007399	Process	Nervous system development	TAS	2236018
GO:0007411	Process	Axon guidance	TAS	19036963
GO:0007416	Process	Synapse assembly	IDA	19036963
GO:0008021	Component	Synaptic vesicle	IBA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008083	Function	Growth factor activity	TAS	2236018
GO:0010832	Process	Negative regulation of myotube differentiation	ISS
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0021675	Process	Nerve development	IBA
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	IBA
GO:0031547	Process	Brain-derived neurotrophic factor receptor signaling pathway	TAS	19036963
GO:0031550	Process	Positive regulation of brain-derived neurotrophic factor receptor signaling pathway	TAS	19036963
GO:0038180	Process	Nerve growth factor signaling pathway	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048668	Process	Collateral sprouting	IDA	19036963
GO:0048672	Process	Positive regulation of collateral sprouting	IDA	19036963
GO:0048812	Process	Neuron projection morphogenesis	IBA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0051965	Process	Positive regulation of synapse assembly	IDA	19036963
GO:2000008	Process	Regulation of protein localization to cell surface	TAS	12130635
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
113505	1033	ENSG00000176697

Protein

UniProt ID

P23560

Protein name

Neurotrophic factor BDNF precursor form (proBDNF) (Abrineurin) (Brain-derived neurotrophic factor) [Cleaved into: Neurotrophic factor BDNF]

Protein function

Important signaling molecule that activates signaling cascades downstream of NTRK2 (PubMed:11152678). During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. P

PDB

1B8M , 1BND

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00243	NGF	133 → 246	Nerve growth factor family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in blood plasma and in saliva (at protein level) (PubMed:11152678, PubMed:19467646). Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, pro

Sequence

MTILFLTMVISYFGCMKAAPMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLA
DTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR

Sequence length

247

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway cAMP signaling pathway PI3K-Akt signaling pathway Neurotrophin signaling pathway Huntington disease Pathways of neurodegeneration - multiple diseases Cocaine addiction Alcoholism		Activated NTRK2 signals through PLCG1 Activated NTRK2 signals through FRS2 and FRS3 NTRK2 activates RAC1

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Congenital Central Hypoventilation	congenital central hypoventilation	N/A	N/A	ClinVar
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Obesity	Obesity, obesity	N/A	N/A	GWAS, ClinVar
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (441)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	30909233
Abdominal Injuries	Associate	31167208
Abdominal Pain	Associate	25358868
Abnormalities Drug Induced	Associate	32493978
Acidemia isovaleric	Associate	20690185
Acne Vulgaris	Inhibit	31234814
Acute Coronary Syndrome	Associate	31887219, 35459929
Acute Pain	Associate	36336706
Adenocarcinoma	Associate	23531103, 26926340
Adenocarcinoma of Lung	Associate	36151890
Adrenal Insufficiency	Associate	25122490
Aging Premature	Associate	19412541
Agnosia	Associate	16818862, 38482990
Akathisia Drug Induced	Associate	22615781
Alcoholism	Associate	25939814
Alzheimer Disease	Associate	12358753, 15935057, 16565926, 16649215, 17293537, 18786162, 18830724, 19542613, 20345896, 20613678, 20967212, 21605064, 21951954, 23924085, 24086677 View all (40 more)
Alzheimer Disease	Inhibit	17344400, 19412541, 20164549, 20377991, 24276217, 26410307, 26819457, 28164772, 28569173, 36170028, 36498925
Amyotrophic Lateral Sclerosis	Associate	29702606, 30572951
Anhedonia	Associate	23240009, 26775293, 29595641, 34325733
Aniridia	Associate	18753648
Anorexia	Associate	17376155, 34856753
Anorexia Nervosa	Associate	17197106, 17376155, 27271855
Anxiety	Associate	19582565, 19931400, 21839144, 23357445, 25425456, 25618300, 26649946, 27005989, 27176146, 28413930, 28416813, 28933046, 29595641, 30711709, 30988377 View all (5 more)
Anxiety	Inhibit	33673283
Anxiety Disorders	Associate	19931400, 21839144, 24247044, 25425456, 25618300, 34425486
Aphasia	Associate	30150003, 31756156, 35428413, 40658687
Apraxias	Associate	23303061, 33407685, 35459929
Arthritis Rheumatoid	Associate	19490633, 22046267, 22715356
Arthritis Rheumatoid	Stimulate	33673283
Asthenozoospermia	Associate	33746583
Asthma	Associate	12900521, 25945802, 26566264, 26662416, 27176146, 27317689, 28522569, 33068389
Ataxia Telangiectasia	Associate	26926340
Atherosclerosis	Associate	28760212, 34580389, 35666604
Athetosis	Associate	24406738
Atrial Fibrillation	Inhibit	28164772
Atrophy	Associate	16740142, 18786162, 24475133, 27521573, 30909233, 34933635, 37948982
Attention Deficit Disorder with Hyperactivity	Associate	19582565, 20943059, 21466746, 21733227, 22362486, 25425456, 28630479
Autism Spectrum Disorder	Associate	19582565, 23517654, 26485544, 29369497, 34030059, 34546355
Autism Spectrum Disorder	Inhibit	31591381
Autism Spectrum Disorder	Stimulate	34518555
Autistic Disorder	Associate	19582215, 20662941, 23517654
Avoidant Restrictive Food Intake Disorder	Associate	20573217
Azoospermia	Associate	36589848
Bipolar Disorder	Associate	12161822, 16472361, 18704093, 19018231, 19193231, 19255578, 19578686, 21098877, 22353757, 22548711, 22760556, 22859933, 23182421, 23931339, 24103632 View all (16 more)
Bipolar Disorder	Inhibit	18787660, 21223646, 24802307
Blood Platelet Disorders	Stimulate	34546355
Blood Platelet Disorders	Associate	36430458
Bone Diseases	Associate	27458153
Bone Diseases Metabolic	Associate	34516503
Borderline Personality Disorder	Associate	19817874, 23422958, 28371657, 32033618
Brain Concussion	Associate	27110438, 27438599, 28755387, 29357818, 32204647
Brain Damage Chronic	Associate	24406738
Brain Diseases	Associate	18056245, 21668081, 24406738, 30014553
Brain Injuries	Associate	17761923, 22188054, 22773554
Brain Injuries Traumatic	Associate	21228168, 22087305, 22188054, 22708958, 24586380, 25063686, 25979196, 27110438, 27438599, 28755387, 29357818, 32024452, 33605167, 34167372, 35465864
Brain Neoplasms	Associate	23531103, 24519935, 27091610, 31123752, 35905534
Breast Neoplasms	Associate	25036590, 26289590, 26967918, 28604807, 29512753, 30550003, 32985495, 33731765, 36463760, 39198096
Breast Neoplasms	Inhibit	29258453
Bronchial Diseases	Associate	24094526
Bronchial Hyperreactivity	Associate	23258230
Bruxism	Associate	34610834
Bulimia	Associate	17376155
Bulimia Nervosa	Associate	17376155
Calcinosis	Associate	37047601
Carcinogenesis	Associate	26926340, 29402794, 34804639, 39412903
Carcinogenesis	Stimulate	34209215
Carcinoma Hepatocellular	Associate	21999199, 27456333, 33929972, 37679418
Carcinoma Non Small Cell Lung	Associate	27456333, 28459374, 33015172
Carcinoma Ovarian Epithelial	Stimulate	18201274
Carcinoma Pancreatic Ductal	Associate	27456333
Carcinoma Renal Cell	Associate	27120782, 33721459, 37657024
Carcinoma Squamous Cell	Associate	26926340, 28604655, 32536035
Carcinoma Verrucous	Stimulate	39412903
Cardiovascular Diseases	Associate	28760212, 31682178, 33073606, 34580389, 35285386
Central Cord Syndrome	Associate	35205376
Central Nervous System Diseases	Associate	21422985, 38417853
Cerebral Infarction	Associate	33029116, 36916413
Cerebral Palsy	Associate	22766130, 35451419
Cerebral Palsy	Inhibit	33497355
Chemotherapy Related Cognitive Impairment	Associate	29258453
Chondrosarcoma	Associate	23874483, 23892595, 28771226
Chromosome 11p partial deletion	Associate	23517654
Chronic Disease	Associate	26739449
Chronic Limb Threatening Ischemia	Associate	39619329
Chronic Pain	Associate	27145806, 35300713, 36336706
Chronic Periodontitis	Associate	25587209
Chronobiology Disorders	Associate	19336781
Cluster Headache	Stimulate	22584531
Cockayne Syndrome	Associate	26972010
Cognition Disorders	Associate	16606648, 16818862, 17130481, 17344400, 17973920, 19412541, 20141627, 20613678, 21695421, 21951954, 22362486, 23517654, 23785422, 24086677, 25288138 View all (43 more)
Cognitive Dysfunction	Inhibit	15935057
Cognitive Dysfunction	Associate	20392958, 21951954, 24475133, 26708060, 27018938, 27521573, 30014553, 30115946, 31348306, 33325388, 33369083, 33447019, 37948982, 38279143, 38454193
Colorectal Neoplasms	Associate	22842573, 28418861, 35586989
Compulsive Personality Disorder	Associate	33757426, 34856753
Congenital central hypoventilation syndrome	Associate	35713175
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	23422958, 25422957, 28009101
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	32493978
Conjunctivitis Allergic	Associate	26989694
Constriction Pathologic	Associate	35666604
Conversion Disorder	Inhibit	28615544
Conversion Disorder	Associate	39236646
Coronary Artery Disease	Associate	21554945, 28760212, 33666096
Coronary Disease	Associate	27608901, 31571628, 31682178, 35282820, 35666604, 36401373
Coronary Disease	Inhibit	31571628
Coronary Stenosis	Associate	35282820
Corticobasal Degeneration	Associate	32397876
Craniocerebral Trauma	Associate	33325388
Deafness	Associate	33787399
Death	Associate	25979196, 36537264
Deglutition Disorders	Associate	32776402
Delayed Emergence from Anesthesia	Associate	22179955, 23628854
Delirium	Associate	39210294
Dementia	Inhibit	23268705, 27995575
Dementia	Associate	24276217, 26410307, 31349032, 32996114, 33300824, 33646145, 34601245, 34639513, 38454193
Depressive Disorder	Associate	17632285, 18548532, 19236730, 19931400, 20163778, 20345896, 20346518, 21218562, 22228829, 22844024, 23133609, 23140671, 23303061, 23968401, 24047966 View all (39 more)
Depressive Disorder	Inhibit	23704927, 24586790, 27852063, 32612092
Depressive Disorder Major	Associate	17632285, 19236730, 19414708, 19931400, 21218562, 22844024, 23968401, 28977521, 29703883, 31889537, 32600964, 33757426, 34325733, 40015617
Depressive Disorder Major	Inhibit	20703451, 24802307, 28509900
Depressive Disorder Treatment Resistant	Stimulate	30994834
Diabetes Mellitus	Associate	23253673, 28900628, 30550003, 34580389, 35459929, 37072879
Diabetes Mellitus Type 1	Associate	33029194
Diabetes Mellitus Type 2	Inhibit	21912638
Diabetes Mellitus Type 2	Associate	23431394, 23968401, 31167208, 33779090
Diabetes Mellitus Type 2	Stimulate	25587547
Diarrhea	Associate	30670915
Diarrhea 5 With Tufting Enteropathy Congenital	Associate	39412903
Diffuse Cerebral Sclerosis of Schilder	Associate	20392958
Diffuse Neurofibrillary Tangles with Calcification	Associate	31349032
Disease	Associate	35205376
Disorder of Sex Development 46 XY	Associate	25122490
Disorders of Excessive Somnolence	Associate	16787984, 30952206
Disorders of Sex Development	Associate	25122490
Disruptive Impulse Control and Conduct Disorders	Associate	33757426, 35328036
Dissociative Disorders	Associate	17608961
Distal Myopathies	Associate	36228098
Drug Hypersensitivity	Associate	22715356, 30670915
Drug Related Side Effects and Adverse Reactions	Associate	22276165
Drug Related Side Effects and Adverse Reactions	Stimulate	34209215
Drug Resistant Epilepsy	Associate	30909076
Dry Eye Syndromes	Associate	26393465
Dyskinesia Drug Induced	Associate	19457211, 22615781, 22766130, 29191473
Dyslexia	Associate	36550387
Dysthymic Disorder	Associate	28615544
Dystonia	Associate	18845611, 19857550
Elejalde Disease	Associate	34831151
Encephalitis	Associate	10049950
Encephalitis	Stimulate	29579552
Endometriosis	Associate	22717347, 26409150, 28125717, 28277116, 35285386, 37918799
Endometriosis	Stimulate	37164275
Eosinophilia	Stimulate	25945802
Epilepsies Partial	Associate	36807083
Epilepsy	Associate	20491871, 21390307, 22654603, 26708060, 30015148, 33757426, 38203674, 40634438
Epilepsy	Inhibit	36807083
Epilepsy Generalized	Associate	30735541
Epilepsy Post Traumatic	Associate	22087305, 35351294
Epilepsy Temporal Lobe	Associate	16818862, 20228460, 29952080, 34102472
Epilepsy Temporal Lobe	Inhibit	40634438
Farber Lipogranulomatosis	Associate	34580389
Fatigue	Associate	27720787, 32848137
Feeding and Eating Disorders	Associate	17376155, 20573217, 21098877, 21851847, 37085692
Fetal Growth Retardation	Associate	40003962
Fibromyalgia	Associate	17611164, 30285822, 32859253, 36336706
Fibrosis	Associate	28522569, 28938915, 37047601
Food Addiction	Associate	21668081
Friedreich Ataxia	Associate	32291635
Frontotemporal Dementia	Associate	32397876
Frontotemporal Lobar Degeneration	Inhibit	31081340
Gallbladder Diseases	Stimulate	23531103
Gallbladder Neoplasms	Associate	20353905
Gastrointestinal Neoplasms	Associate	29459716, 31339548
Gastrointestinal Stromal Tumors	Associate	34804639
Gaucher Disease	Associate	36430458
general anxiety disorder	Associate	30882674, 35866837
Genetic Diseases Inborn	Associate	30014553, 35099506
Giant Cell Arteritis	Associate	25418464
Glaucoma	Associate	32985274
Glaucoma Open Angle	Associate	25893192
Glioma	Associate	23576602, 34953024, 37100464
Granuloma	Associate	21059230
Granulosa Cell Tumor	Associate	28282971
Graves Ophthalmopathy	Associate	37175781
Growth Disorders	Associate	30134862
Hallucinations	Associate	19542613
Head Injuries Penetrating	Associate	22087305
Headache Disorders Primary	Associate	22584531
Hearing Loss Noise Induced	Associate	34493277
Heart Diseases	Associate	21509595, 21951954, 36807083
Heart Failure	Associate	32703621, 35501813, 36074967
Hemorrhage	Associate	22773554
Hemorrhage	Inhibit	36430458
Hepatolenticular Degeneration	Associate	23519890
Heredodegenerative Disorders Nervous System	Associate	21556959, 40133606
Hippocampal Sclerosis	Associate	24086677, 30014553, 38203674
HIV Infections	Associate	21422985
HIV Infections	Inhibit	27995575
HIV Infections	Stimulate	37445902
Huntington Disease	Associate	18093249, 19228174, 22748967, 33378838, 33568689, 33631722, 34296279, 37287291
Huntington Disease	Inhibit	18093249, 21857974, 33065279
Hydranencephaly	Associate	21228168
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	28056856
Hyperkinesis	Associate	17130481, 32493978
Hyperphagia	Associate	17130481, 23967328, 29061165
Hypertension	Associate	19210038
Hypertension Pulmonary	Stimulate	26192455
Hypokinesia	Associate	22615781
Hypothalamic hamartomas	Associate	25307426
Hypothyroidism	Inhibit	32597152
Hypothyroidism	Associate	34879183, 35843716
Hypoxia	Inhibit	18486103
Hypoxia	Stimulate	24462831, 26192455
Hypoxia	Associate	26842559, 30046375
Hypoxia Brain	Associate	36401373
Ichthyosis Bullosa of Siemens	Associate	30622656
Idiopathic Pulmonary Fibrosis	Associate	28938915
Immune System Diseases	Associate	34831151
Infarction Middle Cerebral Artery	Stimulate	36916413
Infections	Associate	24094526
Infertility	Associate	28277116, 34054723
Inflammation	Associate	10049950, 12900521, 23303061, 23899746, 24094526, 24406738, 25587547, 26967918, 27317689, 28164772, 28522569, 28640909, 32024452, 33673283, 34546355, 35205376, 35666604, 35866837 View all (3 more)
Inflammation	Inhibit	21672499, 40133606
Insulin Resistance	Associate	23253673, 29369497
Insulin Resistance	Stimulate	25587547
Intellectual Disability	Associate	18753648, 38482990
Internal Hernia	Associate	25422957
Intervertebral Disc Degeneration	Associate	18727839, 33652921, 36642939
Intervertebral disc disease	Associate	30143695
Intracranial Arteriovenous Malformations	Associate	22773554
Irritable Bowel Syndrome	Stimulate	30670915
Ischemia	Stimulate	15579199
Ischemic Attack Transient	Associate	33076256
Ischemic Stroke	Associate	32576868
Kleefstra Syndrome	Associate	39343771
Language Disorders	Associate	31756156
Lead Poisoning Nervous System	Associate	20618400
Learning Disabilities	Associate	32493978, 36550387
Leiomyosarcoma	Associate	22911740
Leukemia	Associate	19059881
Leukemia Lymphocytic Chronic B Cell	Associate	29059151, 29705266, 32724091
Leukemia Lymphoma Adult T Cell	Stimulate	25210182
Leukemic Infiltration	Associate	27519317
Lung Diseases	Associate	28459374
Lung Neoplasms	Associate	26926340, 27456333, 34209215
Lupus Erythematosus Systemic	Associate	16606648
Lupus Erythematosus Systemic	Stimulate	24223945
Lupus Erythematosus Systemic	Inhibit	36506019
Lymphatic Metastasis	Inhibit	28459374
Lymphatic Metastasis	Stimulate	29989647, 36151890
Lymphoblastic Transformation Inhibition of	Associate	30967530
Lymphoma	Associate	19716854
Lymphoma Large B Cell Diffuse	Associate	19716854
Lymphoma Non Hodgkin	Associate	19716854
Lymphoma T Cell Cutaneous	Associate	22948508
Macular Degeneration	Stimulate	35370941
Macular Degeneration	Associate	36361771
Mania	Inhibit	27270858
Melanoma	Associate	27344179, 27510459
Memory Disorders	Associate	16818862, 20662942, 25288138, 26410307, 26496261, 27521573, 28099630, 28720165, 28755387, 28933046, 32493978, 32985495, 33325388, 33926045, 34997117, 35099506, 36977737 View all (2 more)
Meningoencephalitis	Associate	24406738
Mental Disorders	Associate	12836135, 15537879, 16649215, 17632285, 18548532, 19255578, 19336781, 19349604, 19414708, 19542613, 20141627, 20400928, 22989210, 23253771, 23785422 View all (32 more)
Mental Retardation X Linked Syndromic Christianson Type	Associate	33568516
Mesothelioma Malignant	Associate	30309369
Metabolic Syndrome	Associate	23890480, 23967328, 31502573
Microphthalmia Syndromic 10	Associate	24086677, 28755387
Migraine Disorders	Associate	17611164
Migraine Disorders	Stimulate	20556464, 22584531
Mood Disorders	Associate	12091467, 12161822, 16649215, 18704093, 18787660, 19018231, 19236730, 19336781, 19931400, 21223646, 21612826, 24398043, 24802307, 24944871, 27695066, 28744117, 28752602, 30711709 View all (3 more)
Motor Neuron Disease	Associate	37569576
Mouth Diseases	Associate	28418939, 32776402
Mouth Neoplasms	Associate	35925599
Movement Disorders	Associate	22615781
Multiple Myeloma	Associate	36565997
Multiple Sclerosis	Associate	10049950, 16740142, 20656764, 23593393, 30352103, 30644699, 35205376, 38003363, 38136952
Multiple Sclerosis	Stimulate	12753507, 23101271
Multiple Sclerosis	Inhibit	36754216
Multiple Sclerosis Relapsing Remitting	Associate	12753507, 16740142
Muscle Rigidity	Associate	22615781, 27695066
Musculoskeletal Diseases	Associate	33368378
Musculoskeletal Pain	Associate	27145806
Myasthenia Gravis	Associate	28045063
Myocardial Infarction	Associate	28760212
Myopathies Structural Congenital	Associate	34546355
Myopia	Inhibit	34160912
Neglected Diseases	Associate	29595641
Neoplasm Metastasis	Associate	27456333, 28604807, 29748024, 33294440, 33721459, 35586989, 35925599, 37918799
Neoplasm Metastasis	Stimulate	28771226, 36151890
Neoplasms	Associate	19424612, 21831423, 21999199, 23285024, 23874483, 23892595, 25036590, 25210182, 27120782, 27456333, 28604807, 28771226, 29402794, 29748024, 29989647 View all (12 more)
Neoplasms	Stimulate	23175149, 35054980
Neoplasms	Inhibit	28459374, 30352834, 32401758, 37566001, 37770565
Neoplasms Adipose Tissue	Associate	16787984, 26526993
Nerve Degeneration	Inhibit	10347207, 20618400, 31885368, 37543811
Nerve Degeneration	Associate	31361762, 32983175
Nervous System Diseases	Associate	24943717, 34879183
Nervous System Malformations	Associate	26972010
Neuralgia	Associate	39674387
Neurobehavioral Manifestations	Associate	26967918
Neuroblastoma	Associate	10347207, 10501184, 12808116, 21419569, 21590687, 21731748, 21990266, 27456333, 29959561, 32389647, 39389992, 8264643
Neuroblastoma	Stimulate	38493476
Neurocognitive Disorders	Associate	16606648, 38482990
Neurocognitive Disorders	Inhibit	27995575
Neurodegenerative Diseases	Associate	11161609, 20345896, 22989210, 23519890, 23785422, 23924085, 24086677, 25893192, 26289590, 28720165, 28755387, 30448615, 32539856, 33833366, 35205376, 36170028, 37085692, 37543811 View all (3 more)
Neurodegenerative Diseases	Inhibit	35008438, 37287291
Neuroinflammatory Diseases	Associate	34486703
Neurologic Manifestations	Associate	17344400, 27449489, 29258453, 30841499, 37287291, 38454193
Neuromuscular Junction Diseases	Associate	34981273
Niemann Pick Disease Type C	Associate	36608914
Nonsyndromic Holoprosencephaly	Associate	28459374
Obesity	Associate	17130481, 18753648, 19692490, 20520848, 20712903, 20843981, 21668081, 21708048, 21779088, 21851847, 22513296, 23326649, 23349760, 23408508, 23628854 View all (29 more)
Obesity	Inhibit	27551991, 28012455, 28677406
Obesity Abdominal	Associate	23424664, 23890480, 31502573, 34525971
Obesity Hypoventilation Syndrome	Associate	35713175
Obesity Maternal	Inhibit	28012455
Obsessive Compulsive Disorder	Associate	12836135, 19664825, 21401876, 21668081, 31004918, 33757426, 36641432
Olfaction Disorders	Associate	23924085, 28334095
Oligospermia	Associate	36589848
Opioid Related Disorders	Associate	30071446
Osteoarthritis	Associate	22715356
Osteolysis	Associate	27458153
Osteoporosis	Associate	28903900, 34516503
Osteoporotic Fractures	Associate	27465306, 31242715, 34516503
Osteosarcoma	Associate	24067459, 30352834, 31002124, 34717683
Ovarian Diseases	Associate	35300713
Ovarian Neoplasms	Associate	28984201, 31298409
Overweight	Inhibit	16787984
Overweight	Associate	21851847, 28056856, 30590963, 35295960
Pain	Associate	16623937, 18727839, 20556464, 22584531, 22963171, 28413930, 32859253, 34486703, 35925599, 39674387
Pancreatic Neoplasms	Associate	34777634
Panic Disorder	Associate	33047489, 33757426
Paranoid Disorders	Associate	18721261
Paresis	Associate	27007747
Parkinson Disease	Associate	12882651, 16565926, 23924085, 26253177, 26497684, 26806863, 29191473, 29547479, 32022467, 33215284, 34288271, 37287291, 38417853, 39392027, 40015617
Parkinson Disease	Stimulate	27220776
Parkinson Disease	Inhibit	36768317
Parkinsonian Disorders	Stimulate	39412903
Parotid Neoplasms	Associate	36266462
Paroxysmal ventricular fibrillation	Associate	34054723
Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcal infections	Associate	28933046
Pediatric Obesity	Associate	17608961, 18753648, 27405617
Periodontal Diseases	Associate	25587209
Periodontitis	Inhibit	36997422
Peripheral Nervous System Diseases	Associate	28900628, 30550003, 35682716, 37426324, 37522679
Peritonitis	Associate	23175149, 35280682
Personality Disorders	Associate	19817874, 36766691
Phobia Social	Associate	19582565, 23357445, 34856753
Pituitary Neoplasms	Associate	22507324
Plaque Amyloid	Associate	31349032
Pleural Effusion	Associate	30309369
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	21228168
Postoperative Cognitive Complications	Associate	33405375
Pre Eclampsia	Associate	21831423, 23654315, 31522565
Precancerous Conditions	Stimulate	37445902
Prostatic Neoplasms	Associate	27121963, 27456333, 31422041, 34573332
Psychological Distress	Associate	26445699
Psychological Trauma	Associate	34856753
Psychomotor Agitation	Associate	24406738
Psychomotor Disorders	Associate	31235756
Psychotic Disorders	Associate	16472361, 18319075, 19336781, 21509595, 22353757, 22766130, 33053385
Psychotic Disorders	Inhibit	21672499
Pulmonary Disease Chronic Obstructive	Associate	26566264, 28744117
Respiratory Distress Syndrome	Associate	28413930, 35351294
Respiratory Hypersensitivity	Associate	19237390
Retinal Diseases	Associate	36361771
Retinal Vein Occlusion	Associate	35370941
Retinitis Pigmentosa	Associate	34089924
Retinoblastoma	Associate	33942699
Retinopathy of Prematurity	Associate	25118269
Retinopathy of Prematurity	Inhibit	31266060
Rett Syndrome	Associate	19349604
Sarcoma	Associate	21059230, 22911740
Sarcoma Ewing	Associate	27145455
Schizophrenia	Associate	16649215, 16818862, 18056245, 19457211, 20100784, 20161799, 21098877, 22362486, 23253673, 23973796, 24556472, 24802307, 25125238, 25264289, 26118823 View all (10 more)
Schizophrenia	Inhibit	21223646, 24468644, 25476119, 33558459
Schizophrenia Spectrum and Other Psychotic Disorders	Associate	16818862
Schizotypal Personality Disorder	Associate	25125238
Schmid Fraccaro syndrome	Associate	23140671
Sciatic Neuropathy	Associate	34663380
Scleroderma Systemic	Inhibit	38570030
Seizures	Associate	19349604, 20491871, 38203674
Seizures	Inhibit	20618400
Severe Acute Respiratory Syndrome	Associate	32996114
Sexual Dysfunctions Psychological	Inhibit	36228098
Sexual Trauma	Associate	19817874, 23182421, 29595641
Signs and Symptoms	Associate	21668081, 29357818
Sjogren's Syndrome	Associate	33708222
Skin Diseases	Associate	10844552
Sleep Apnea Obstructive	Associate	30952206, 36499215
Sleep Deprivation	Associate	22379239, 26276912, 28947280
Sleep Deprivation	Stimulate	24586790
Sleep Wake Disorders	Associate	22379239, 30952206
Small Cell Lung Carcinoma	Associate	27852063, 29748024
Smoke Inhalation Injury	Associate	21436384, 30659208
Somatoform Disorders	Associate	17611164
Specific Language Disorder	Associate	20948219
Spherocytosis Type 1	Stimulate	20228460
Spinal Cord Injuries	Associate	27526567, 28790168
Spondylitis Ankylosing	Associate	15817657
Squamous Cell Carcinoma of Head and Neck	Associate	22276165, 30641914, 35925599, 39412903
Starvation	Associate	27271855
Status Asthmaticus	Associate	23195334, 25945802, 33068389
Status Asthmaticus	Stimulate	27317689, 28522569
Stomach Neoplasms	Associate	16367923, 23175149, 27458153, 31339548, 35280682
Stress Disorders Post Traumatic	Associate	16649215, 22654603, 27110438, 30988377, 33926045, 34425486, 36977737, 37692110
Stress Disorders Traumatic	Associate	27110438
Stroke	Associate	18845611, 22221491, 23240009, 25241287, 25470006, 26381810, 26487176, 29480080, 30338813, 31756156, 32776402, 32996114, 33029116, 33182716, 33306691 View all (5 more)
Subarachnoid Hemorrhage	Associate	17761923
Substance Related Disorders	Associate	16649215, 21098877, 33757426, 34856753, 38255861
Substance Related Disorders	Inhibit	20703451
Syndrome	Associate	36589848
Syphilis	Associate	32189000
Tardive Dyskinesia	Associate	22615781
Tarlov Cysts	Associate	35925599
Thinness	Associate	21851847
Thyroid Diseases	Associate	34879183
Thyroid Neoplasms	Associate	31210313
Thyroiditis Autoimmune	Inhibit	32597152
Thyroiditis Autoimmune	Associate	35843716
Tics	Associate	19582565
Tinnitus	Inhibit	28615544
Tinnitus	Associate	37736859
Tobacco Use Disorder	Associate	25183693, 25618300, 30659208, 33757426
Tomaculous neuropathy	Associate	36430458
Torticollis	Associate	19857550
Tremor	Associate	22615781
Triple Negative Breast Neoplasms	Associate	28800782, 32401758
Tuberculosis Multidrug Resistant	Associate	29512753
Tuberous Sclerosis	Associate	11583980
Turner Syndrome	Stimulate	24397357
Urinary Bladder Neoplasms	Associate	25569276, 29402794
Urogenital Abnormalities	Associate	18753648
Uterine Cervical Neoplasms	Associate	29989647, 37445902
Uterine Cervicitis	Associate	37445902
Vascular Diseases	Associate	26192455
Virus Diseases	Stimulate	24406738
Vision Low	Associate	16606648
Vitiligo	Associate	35905107
WAGR Syndrome	Associate	18753648, 23517654
Weight Gain	Associate	32493978
Weight Loss	Associate	23628854, 39743445
Wilms Tumor	Associate	18753648
Wounds and Injuries	Associate	17608961, 26286685, 29595641, 30046375, 30988377, 33053385, 34425486, 36977737
Wounds and Injuries	Stimulate	21672499
Wrist Fractures	Associate	34516503

BDNF (brain derived neurotrophic factor)