Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6258
Gene name Gene Name - the full gene name approved by the HGNC.	Retinoid X receptor gamma
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RXRG
Synonyms (NCBI Gene) Gene synonyms aliases	NR2B3, RXR-gamma, RXRC, RXRgamma
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments
MIRT1323494	hsa-miR-106a	CLIP-seq
MIRT1323495	hsa-miR-106b	CLIP-seq
MIRT1323496	hsa-miR-17	CLIP-seq
MIRT1323497	hsa-miR-20a	CLIP-seq
MIRT1323498	hsa-miR-20b	CLIP-seq
MIRT1323499	hsa-miR-3160-5p	CLIP-seq
MIRT1323500	hsa-miR-3180-5p	CLIP-seq
MIRT1323501	hsa-miR-3689a-3p	CLIP-seq
MIRT1323502	hsa-miR-3689c	CLIP-seq
MIRT1323503	hsa-miR-3689d	CLIP-seq
MIRT1323504	hsa-miR-4685-5p	CLIP-seq
MIRT1323505	hsa-miR-4728-5p	CLIP-seq
MIRT1323506	hsa-miR-519d	CLIP-seq
MIRT1323507	hsa-miR-579	CLIP-seq
MIRT1323508	hsa-miR-765	CLIP-seq
MIRT1323509	hsa-miR-93	CLIP-seq
MIRT2320354	hsa-miR-1293	CLIP-seq
MIRT2320355	hsa-miR-1343	CLIP-seq
MIRT2320356	hsa-miR-2110	CLIP-seq
MIRT2320357	hsa-miR-23a	CLIP-seq
MIRT2320358	hsa-miR-23b	CLIP-seq
MIRT2320359	hsa-miR-23c	CLIP-seq
MIRT2320360	hsa-miR-3144-5p	CLIP-seq
MIRT2320361	hsa-miR-3150a-3p	CLIP-seq
MIRT2320362	hsa-miR-3175	CLIP-seq
MIRT1323500	hsa-miR-3180-5p	CLIP-seq
MIRT2320363	hsa-miR-3191	CLIP-seq
MIRT2320364	hsa-miR-4260	CLIP-seq
MIRT2320365	hsa-miR-4474-3p	CLIP-seq
MIRT2320366	hsa-miR-4476	CLIP-seq
MIRT2320367	hsa-miR-4483	CLIP-seq
MIRT2320368	hsa-miR-4511	CLIP-seq
MIRT2320369	hsa-miR-4652-5p	CLIP-seq
MIRT2320370	hsa-miR-4793-5p	CLIP-seq
MIRT2320371	hsa-miR-485-5p	CLIP-seq
MIRT2320372	hsa-miR-491-5p	CLIP-seq
MIRT2320373	hsa-miR-520a-5p	CLIP-seq
MIRT2320374	hsa-miR-525-5p	CLIP-seq
MIRT2320375	hsa-miR-939	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003707	Function	Nuclear steroid receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0004879	Function	Nuclear receptor activity	TAS	8034312
GO:0005515	Function	Protein binding	IPI	16189514, 20133701, 20211142, 21516116, 21900206, 21988832, 25303530, 25416956, 25910212, 28514442, 29892012, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044323	Function	Retinoic acid-responsive element binding	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	31881311
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
180247	10479	ENSG00000143171

Protein

UniProt ID

P48443

Protein name

Retinoic acid receptor RXR-gamma (Nuclear receptor subfamily 2 group B member 3) (Retinoid X receptor gamma)

Protein function

Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR

PDB

2GL8 , 7A79

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11825	Nuc_recep-AF1	25 → 134	Nuclear/hormone receptor activator site AF-1	Family
PF00105	zf-C4	137 → 206	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	255 → 443	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level). {ECO:0000269|PubMed:28167758}.

Sequence

MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT

Sequence length

463

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Th17 cell differentiation Thyroid hormone signaling pathway Adipocytokine signaling pathway Parathyroid hormone synthesis, secretion and action Pathways in cancer Transcriptional misregulation in cancer Chemical carcinogenesis - receptor activation Thyroid cancer Small cell lung cancer Non-small cell lung cancer Gastric cancer Lipid and atherosclerosis		Nuclear Receptor transcription pathway Signaling by Retinoic Acid

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aphasia	Associate	27251476
Breast Neoplasms	Associate	29073238, 31558802
Carcinogenesis	Associate	40155870
Carcinoma Renal Cell	Inhibit	40155870
Colorectal Neoplasms	Associate	31525256
Developmental Disabilities	Associate	27251476
Diabetes Gestational	Associate	27636996, 34633445
Diabetic Retinopathy	Associate	22180072
Eye Diseases	Associate	36490268
Lung Neoplasms	Associate	31526458
Metabolic Syndrome	Inhibit	25867398
Neoplasm Metastasis	Associate	31558802
Neoplasms	Associate	31525256
Neoplasms	Inhibit	31558802, 40155870
Sarcopenia	Associate	36147639
Scotoma	Associate	27251476

RXRG (retinoid X receptor gamma)