RTN1 (reticulon 1)

Gene

• Entrez ID: 6252
• Gene name: Reticulon 1
• Gene symbol: RTN1
• Synonyms (NCBI Gene): NSP
• Chromosome: 14
• Chromosome location: 14q23.1
• Summary: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. This gene is considered to be a specifi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1321937	hsa-miR-147	CLIP-seq
MIRT1321938	hsa-miR-3140-3p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT737878	hsa-miR-4711-5p	CLIP-seq
MIRT2458688	hsa-miR-138	CLIP-seq
MIRT2458689	hsa-miR-142-5p	CLIP-seq
MIRT2458690	hsa-miR-2054	CLIP-seq
MIRT2458691	hsa-miR-3143	CLIP-seq
MIRT2458692	hsa-miR-561	CLIP-seq
MIRT2465990	hsa-miR-548ac	CLIP-seq
MIRT2465991	hsa-miR-548ae	CLIP-seq
MIRT2465992	hsa-miR-548aj	CLIP-seq
MIRT2465993	hsa-miR-548am	CLIP-seq
MIRT2465994	hsa-miR-548d-3p	CLIP-seq
MIRT2465995	hsa-miR-548x	CLIP-seq
MIRT2465996	hsa-miR-548z	CLIP-seq
MIRT1321937	hsa-miR-147	CLIP-seq
MIRT1321938	hsa-miR-3140-3p	CLIP-seq
MIRT1321937	hsa-miR-147	CLIP-seq
MIRT1321938	hsa-miR-3140-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	12873973
GO:0000139	Component	Golgi membrane	IEA
GO:0005515	Function	Protein binding	IPI	12873973, 15286784, 17684057, 17786215, 25416956, 25543119, 25612671, 32814053
GO:0005783	Component	Endoplasmic reticulum	IDA	12873973
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	17684057
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	8833145
GO:0005794	Component	Golgi apparatus	IEA
GO:0007420	Process	Brain development	IBA
GO:0014069	Component	Postsynaptic density	IBA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	IEP	9560466
GO:0030425	Component	Dendrite	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0071787	Process	Endoplasmic reticulum tubular network formation	IBA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IDA	15286784
GO:1902430	Process	Negative regulation of amyloid-beta formation	IEA
GO:1990809	Process	Endoplasmic reticulum tubular network membrane organization	IBA

Other IDs

• MIM: 600865
• HGNC: 10467
• e!Ensembl: ENSG00000139970

Protein

• UniProt ID: Q16799
• Protein name: Reticulon-1 (Neuroendocrine-specific protein)
• Protein function: Inhibits amyloid precursor protein processing, probably by blocking BACE1 activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02453	Reticulon	589 → 753	Reticulon	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation. {ECO:0000269|PubMed:9560466}.
• Sequence:

  MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAAS
  REAGSGPARQSPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDS
  TYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNK
  ILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPD
  KPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKT
  PEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGSISEDELITAI
  KEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP
  MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEES
  PKREQDSPPMKPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGD
  GALEPETPMLPRKPEEDSSSNQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQ
  TGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAY
  LELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFN
  GLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE

• Sequence length: 776

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Insomnia	Insomnia	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Cancer Pain	Associate	24690158
Colonic Neoplasms	Associate	26404086
Colorectal Neoplasms	Associate	26404086
Diabetes Mellitus Type 2	Associate	26496126
Gastrointestinal Stromal Tumors	Associate	20548289
Kidney Diseases	Associate	26496126
Kidney Failure Chronic	Associate	26496126
Lymphoma Large B Cell Diffuse	Associate	34702929
Mental Disorders	Associate	30626913
Neoplasms	Inhibit	20548289
Neoplasms	Associate	26404086
Schizophrenia	Associate	30626913
Warts	Associate	31892232