Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6240
Gene name	Ribonucleotide reductase catalytic subunit M1
Gene symbol	RRM1
Synonyms (NCBI Gene)	PEOB6R1RIR1RR1
Chromosome	11
Chromosome location	11p15.4
Summary	This gene encodes the large and catalytic subunit of ribonucleotide reductase, an enzyme essential for the conversion of ribonucleotides into deoxyribonucleotides. A pool of available deoxyribonucleotides is important for DNA replication during S phase of

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004159	hsa-miR-192-5p	Microarray	16822819
MIRT023637	hsa-miR-1-3p	Proteomics	18668040
MIRT049472	hsa-miR-92a-3p	CLASH	23622248
MIRT046549	hsa-let-7i-5p	CLASH	23622248
MIRT037088	hsa-miR-877-3p	CLASH	23622248
MIRT459746	hsa-miR-6863	PAR-CLIP	23592263
MIRT459745	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT459744	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT459743	hsa-miR-4459	PAR-CLIP	23592263
MIRT459742	hsa-miR-665	PAR-CLIP	23592263
MIRT459741	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459740	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT459739	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT459738	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT459737	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT459736	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT459735	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT459734	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT046549	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT459733	hsa-miR-4458	PAR-CLIP	23592263
MIRT459732	hsa-miR-4500	PAR-CLIP	23592263
MIRT459731	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT459730	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT459729	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT459728	hsa-miR-4792	PAR-CLIP	23592263
MIRT459727	hsa-miR-4710	PAR-CLIP	23592263
MIRT459726	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT459725	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT459724	hsa-miR-1273e	PAR-CLIP	23592263
MIRT459746	hsa-miR-6863	PAR-CLIP	23592263
MIRT459745	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT459744	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT459743	hsa-miR-4459	PAR-CLIP	23592263
MIRT459742	hsa-miR-665	PAR-CLIP	23592263
MIRT459741	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT459740	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT459739	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT459738	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT459737	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT459736	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT459735	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT459734	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT046549	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT459733	hsa-miR-4458	PAR-CLIP	23592263
MIRT459732	hsa-miR-4500	PAR-CLIP	23592263
MIRT459731	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT459730	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT459729	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT459728	hsa-miR-4792	PAR-CLIP	23592263
MIRT459727	hsa-miR-4710	PAR-CLIP	23592263
MIRT459726	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT459725	hsa-miR-7855-5p	PAR-CLIP	23592263
MIRT459724	hsa-miR-1273e	PAR-CLIP	23592263
MIRT1319686	hsa-miR-3619-3p	CLIP-seq
MIRT1319687	hsa-miR-3942-3p	CLIP-seq
MIRT2095000	hsa-miR-338-3p	CLIP-seq
MIRT2095001	hsa-miR-4509	CLIP-seq
MIRT2095002	hsa-miR-4519	CLIP-seq
MIRT2095003	hsa-miR-4530	CLIP-seq
MIRT2095004	hsa-miR-545	CLIP-seq
MIRT2319346	hsa-miR-101	CLIP-seq
MIRT2319347	hsa-miR-132	CLIP-seq
MIRT2319348	hsa-miR-212	CLIP-seq
MIRT2615014	hsa-miR-1468	CLIP-seq
MIRT2615015	hsa-miR-339-5p	CLIP-seq
MIRT2615016	hsa-miR-33a	CLIP-seq
MIRT2615017	hsa-miR-33b	CLIP-seq
MIRT2615018	hsa-miR-450b-5p	CLIP-seq
MIRT2615019	hsa-miR-4696	CLIP-seq
MIRT2615020	hsa-miR-4800-3p	CLIP-seq
MIRT2615021	hsa-miR-507	CLIP-seq
MIRT2615022	hsa-miR-513c	CLIP-seq
MIRT2615023	hsa-miR-514b-5p	CLIP-seq
MIRT2615024	hsa-miR-548a-3p	CLIP-seq
MIRT2615025	hsa-miR-548e	CLIP-seq
MIRT2615026	hsa-miR-548f	CLIP-seq
MIRT2615027	hsa-miR-557	CLIP-seq
MIRT2690037	hsa-miR-1305	CLIP-seq
MIRT2615014	hsa-miR-1468	CLIP-seq
MIRT2615015	hsa-miR-339-5p	CLIP-seq
MIRT2615016	hsa-miR-33a	CLIP-seq
MIRT2615017	hsa-miR-33b	CLIP-seq
MIRT2690038	hsa-miR-4422	CLIP-seq
MIRT2615018	hsa-miR-450b-5p	CLIP-seq
MIRT2615019	hsa-miR-4696	CLIP-seq
MIRT2615020	hsa-miR-4800-3p	CLIP-seq
MIRT2615021	hsa-miR-507	CLIP-seq
MIRT2615022	hsa-miR-513c	CLIP-seq
MIRT2615023	hsa-miR-514b-5p	CLIP-seq
MIRT2615024	hsa-miR-548a-3p	CLIP-seq
MIRT2615025	hsa-miR-548e	CLIP-seq
MIRT2615026	hsa-miR-548f	CLIP-seq
MIRT2615027	hsa-miR-557	CLIP-seq
MIRT2690039	hsa-miR-607	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
E2F1	Activation	14618416
TFDP1	Activation	14618416

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000731	Process	DNA synthesis involved in DNA repair	NAS	10716435
GO:0003824	Function	Catalytic activity	IEA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IBA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	IEA
GO:0004748	Function	Ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor	ISS
GO:0005515	Function	Protein binding	IPI	17726094, 21336276, 22632967, 28514442, 32296183, 33961781
GO:0005524	Function	ATP binding	IBA
GO:0005524	Function	ATP binding	IEA
GO:0005635	Component	Nuclear envelope	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA	18997010
GO:0005829	Component	Cytosol	TAS
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	IBA
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	IEA
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	IPI	22632967
GO:0005971	Component	Ribonucleoside-diphosphate reductase complex	ISS
GO:0006206	Process	Pyrimidine nucleobase metabolic process	IEA
GO:0006264	Process	Mitochondrial DNA replication	IEA
GO:0006264	Process	Mitochondrial DNA replication	IMP	17486094
GO:0006281	Process	DNA repair	IDA	11719458
GO:0008584	Process	Male gonad development	IEA
GO:0009185	Process	Ribonucleoside diphosphate metabolic process	IDA	16376858
GO:0009185	Process	Ribonucleoside diphosphate metabolic process	IEA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	IBA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	IEA
GO:0009263	Process	Deoxyribonucleotide biosynthetic process	ISS
GO:0009265	Process	2'-deoxyribonucleotide biosynthetic process	IDA	16376858
GO:0009265	Process	2'-deoxyribonucleotide biosynthetic process	IEA
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	10716435
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0017076	Function	Purine nucleotide binding	IEA
GO:0021846	Process	Cell proliferation in forebrain	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0036064	Component	Ciliary basal body	IDA
GO:0042802	Function	Identical protein binding	IPI	17726094, 21336276, 25416956
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0051290	Process	Protein heterotetramerization	IEA
GO:0060041	Process	Retina development in camera-type eye	IEA
GO:0061731	Function	Ribonucleoside-diphosphate reductase activity	IEA
GO:0061731	Function	Ribonucleoside-diphosphate reductase activity	IMP	21336276
GO:0070318	Process	Positive regulation of G0 to G1 transition	IDA	11517226
GO:0070318	Process	Positive regulation of G0 to G1 transition	IEA
GO:0097718	Function	Disordered domain specific binding	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	24253041

MIM	HGNC	e!Ensembl
180410	10451	ENSG00000167325

P23921

Protein name

Ribonucleoside-diphosphate reductase large subunit (EC 1.17.4.1) (Ribonucleoside-diphosphate reductase subunit M1) (Ribonucleotide reductase large subunit)

Protein function

Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.

PDB

2WGH , 3HNC , 3HND , 3HNE , 3HNF , 4X3V , 5D1Y , 5TUS , 6AUI , 6L3R , 6L7L , 6LKM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03477	ATP-cone	1 → 89	ATP cone domain	Domain
PF00317	Ribonuc_red_lgN	141 → 213	Ribonucleotide reductase, all-alpha domain	Domain
PF02867	Ribonuc_red_lgC	216 → 738	Ribonucleotide reductase, barrel domain	Family

Sequence

MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLA
AETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKST
LDIVLANKDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHK
EDIDAAIETYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCAL
ISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIY
LEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLD
EVWGEEFEKLYASYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
GTIKCSNLCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKI
IDINYYPVPEACLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGAL
EASCDLAKEQGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIA
PMPTASTAQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWHEEMKNQII
ACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKL
TSMHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKERNTAAMVCS
LENRDECLMCGS

Sequence length

792

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Pyrimidine metabolism Glutathione metabolism Drug metabolism - other enzymes Metabolic pathways Nucleotide metabolism		Interconversion of nucleotide di- and triphosphates

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Progressive external ophthalmoplegia with mitochondrial dna deletions, autosomal recessive 6	Likely pathogenic; Pathogenic	rs2094584404, rs141634151	RCV003447337 RCV003447444
RRM1-related disorder	Likely pathogenic	rs2094584404	RCV003153041

Show/Hide Text Mining Associations (69)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	22569992, 23038758, 23470290, 26374242, 30458017
Adenocarcinoma of Lung	Associate	18414411, 40191558
Adrenal Cortex Neoplasms	Associate	25497672
Adrenal Gland Neoplasms	Associate	25497672
Adrenocortical Carcinoma	Associate	22547773
Amyotrophic Lateral Sclerosis	Associate	23558684, 24464995, 26883171
Autoimmune enteropathy	Associate	1361864
Biliary Tract Diseases	Associate	22760605
Brain Neoplasms	Associate	29923182
Breast Neoplasms	Associate	12938148, 19968494, 21394302, 24215511, 24578158, 33832110
Carcinogenesis	Associate	17314339
Carcinoma	Associate	26453115
Carcinoma Hepatocellular	Stimulate	36713030
Carcinoma Hepatocellular	Associate	39563436
Carcinoma Non Small Cell Lung	Associate	15277258, 16980606, 17314339, 18376380, 18442042, 19002265, 19884554, 20226083, 21224045, 21370501, 21642870, 22028294, 22052224, 22173087, 22439756 View all (22 more)
Carcinoma Pancreatic Ductal	Associate	20927319, 22436573, 39577749
Carcinoma Squamous Cell	Associate	23470290
Cholangiocarcinoma	Associate	25032731, 26374242
Colorectal Neoplasms	Inhibit	25638032
Colorectal Neoplasms	Associate	26553611, 28949378
Cone Rod Dystrophies	Associate	35656873
Death	Associate	23038758, 25227663, 26200905
Dowling Degos Disease	Associate	25497672
Drug Related Side Effects and Adverse Reactions	Associate	23118991, 26028097
Frontotemporal Dementia	Associate	31605140
Glioblastoma	Associate	27579614
Immunologic Deficiency Syndromes	Inhibit	35617047
Immunologic Deficiency Syndromes	Associate	35617047
Intellectual Disability	Associate	23922955
Leiomyosarcoma	Associate	26612755
Leukemia Myeloid Acute	Associate	24024897, 26083014, 29141648, 29631596
Lung Diseases	Associate	26553611
Lung Neoplasms	Associate	17314339, 20438561, 24614341, 26612755, 27335251, 27587543, 32638267
Lymphatic Metastasis	Stimulate	26453115
Lymphoma Non Hodgkin	Associate	27173327
Medulloblastoma	Associate	29869738
Mesothelioma Malignant	Associate	34353292
Microvascular Angina	Associate	36973651
Multiple Myeloma	Associate	22147262, 28878380, 35197447
Muscle Neoplasms	Associate	20438561
Nasopharyngeal Carcinoma	Associate	22692073
Nausea	Associate	25227833
Neoplasm Metastasis	Inhibit	25638032
Neoplasm Metastasis	Associate	26553611
Neoplasms	Associate	17314339, 18827606, 19395913, 19543324, 20226083, 22569992, 22736490, 23803067, 24155212, 24578158, 24647522, 25119181, 25638032, 26200905, 26453115 View all (7 more)
Neoplasms	Stimulate	36713030
Neurofibrosarcoma	Associate	28556483
Neutropenia	Associate	20665488
Ophthalmoplegia	Associate	35617047
Pancreatic Neoplasms	Associate	17224927, 19543324, 19968494, 20665488, 21264835, 21487324, 22692073, 22736490, 23710668, 25837929, 34111175, 36866763, 40155654
Ptosis Hereditary Congenital 2	Associate	35617047
Pulmonary Disease Chronic Obstructive	Associate	22044695, 36899372
Rectal Neoplasms	Associate	25380052
Refsum Disease Infantile	Associate	35656873
Retinal Degeneration	Associate	35656873
Retinitis Pigmentosa	Associate	35656873
Sarcoma Ewing	Associate	37599787, 40478628
Sleep Initiation and Maintenance Disorders	Associate	35617047
Small Cell Lung Carcinoma	Associate	20107425
Stomach Neoplasms	Associate	28056823
Stomatitis	Associate	29865035
TDP 43 Proteinopathies	Associate	24464995
Tertiary Lymphoid Structures	Associate	23922955
Thyroid Cancer Papillary	Associate	26453115
Thyroid Neoplasms	Associate	26453115
Urethral Neoplasms	Associate	20438561, 26200905
Urinary Bladder Neoplasms	Associate	29941343, 31340801
Usher Syndromes	Associate	35656873
Vomiting	Associate	23118991, 25227833

RRM1 (ribonucleotide reductase catalytic subunit M1)