RRAS (RAS related)

Gene

• Entrez ID: 6237
• Gene name: RAS related
• Gene symbol: RRAS
• Synonyms (NCBI Gene): R-Ras, RRAS1
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022156	hsa-miR-124-3p	Microarray	18668037
MIRT025259	hsa-miR-34a-5p	Sequencing	20371350
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT1319469	hsa-miR-124	CLIP-seq
MIRT1319470	hsa-miR-128	CLIP-seq
MIRT1319471	hsa-miR-298	CLIP-seq
MIRT1319472	hsa-miR-34a	CLIP-seq
MIRT1319473	hsa-miR-34c-5p	CLIP-seq
MIRT1319474	hsa-miR-449b	CLIP-seq
MIRT1319475	hsa-miR-506	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2094918	hsa-miR-1343	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2094920	hsa-miR-3192	CLIP-seq
MIRT2094921	hsa-miR-3657	CLIP-seq
MIRT2094922	hsa-miR-3928	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2094924	hsa-miR-4669	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2393896	hsa-miR-18a	CLIP-seq
MIRT2393897	hsa-miR-18b	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2393898	hsa-miR-3144-5p	CLIP-seq
MIRT2393899	hsa-miR-3191	CLIP-seq
MIRT2393900	hsa-miR-377	CLIP-seq
MIRT2393901	hsa-miR-4652-5p	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2393902	hsa-miR-4735-3p	CLIP-seq
MIRT2393903	hsa-miR-4761-5p	CLIP-seq
MIRT2393904	hsa-miR-491-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002521	Process	Leukocyte differentiation	IMP	24705357
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	16773572
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	24705357
GO:0003924	Function	GTPase activity	TAS	3098437
GO:0005515	Function	Protein binding	IPI	17474147, 19843518, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	TAS	3098437
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	22825554
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	IDA	16773572
GO:0019003	Function	GDP binding	IMP	24705357
GO:0036135	Process	Schwann cell migration	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24705357
GO:0060325	Process	Face morphogenesis	IMP	24705357
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IMP	24705357
GO:1900148	Process	Negative regulation of Schwann cell migration	IEA
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	22825554
GO:2001214	Process	Positive regulation of vasculogenesis	IMP	22825554

Other IDs

• MIM: 165090
• HGNC: 10447
• e!Ensembl: ENSG00000126458

Protein

• UniProt ID: P10301
• Protein name: Ras-related protein R-Ras (EC 3.6.5.2) (p23)
• Protein function: GTP-binding protein with GTPase activity, likely involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PubMed:39809765). Regulates the organization of the actin cytoskeleton (PubMed:16537651, P
• PDB: 2FN4, 7S0Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	31 → 192	Ras family	Domain

• Sequence:

  MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
  TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
  KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
  EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

• Sequence length: 218

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Mitophagy - animal
Autophagy - animal
Cellular senescence
Axon guidance
Apelin signaling pathway
C-type lectin receptor signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Proteoglycans in cancer

Reactome:

Sema4D mediated inhibition of cell attachment and migration

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Hereditary cancer	Uncertain significance	rs369508242	RCV005231202
Malignant lymphoma, large B-cell, diffuse	Benign	rs731861	RCV005898613
Malignant tumor of esophagus	Conflicting classifications of pathogenicity	rs375821724	RCV005925577
Noonan syndrome	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	rs759803129, rs762794552, rs767209383, rs151171681, rs925991568, rs2122416729, rs369508242, rs2122416934, rs374077706, rs578092373, rs750643775, rs776793181, rs370876982, rs773121618, rs2122418958, rs370459010, rs765681955, rs114187560, rs1458889244, rs781054110, rs753238136, rs1358894507, rs761080520, rs1446034967, rs758697481, rs928367564, rs1162722748, rs2122429748, rs2122419368, rs1428526675, rs778415296, rs376005750, rs557007484, rs375821724, rs200100211, rs756447228, rs748655822, rs2122419131, rs368625677, rs774803334, rs764597042, rs1379523599, rs769754956, rs1039650903, rs1017555483, rs901769495, rs1287689249, rs766707816, rs369240501, rs756598983, rs755565332, rs556200895, rs1447937831, rs2081015676, rs1349125359, rs1599813084, rs755237250, rs2122429906, rs377060262, rs2122419483, rs372538436, rs780638908, rs1354856207, rs1249345635, rs544651800, rs2122429854, rs369700575, rs1017127642, rs754204165, rs2122417189, rs775471738, rs2122418915, rs781768996, rs199924228, rs149038492, rs765391621, rs2513709636, rs2513705524, rs576507390, rs142277653, rs745391652, rs925989732, rs749613582, rs1411684410, rs751721094, rs772623819, rs202189880, rs1437320392, rs1159717303, rs767471796, rs1331975394, rs934417178, rs1384244882, rs774785666, rs751389740, rs769130245, rs2513709876, rs2513705350, rs777784351, rs1488434625, rs1599813249, rs1353880358, rs2513706356, rs1484904489, rs772132258, rs1450511485, rs546673930, rs1413308540, rs749106517, rs761629413, rs1199131412, rs2513709614, rs2513706286, rs199540462, rs765114836, rs777971803, rs2080992973, rs1341388245, rs775638060, rs2513707043, rs564198320, rs148755459, rs1297251901, rs779217242, rs747390514, rs756472044, rs1010709642, rs1316671612, rs2513706946, rs2513705270, rs199656328, rs1271173516, rs369157989, rs967945950, rs774218911, rs1260602560, rs2081014508, rs2080999294, rs2081015423, rs61760904, rs372925843, rs183538580, rs145907892, rs116683551, rs1421164782, rs1490597941, rs731861, rs1368464, rs1865077, rs201690554, rs117957448, rs138124318, rs151014532, rs2230917, rs754342165, rs757080959, rs557964716, rs754976061, rs1272875791, rs145282813, rs760978291, rs1568436933, rs908791453, rs988964363, rs374650566, rs369588682, rs1568436746, rs537601977, rs373359206, rs766259420, rs775437600, rs1166281308, rs1423079476, rs896071517, rs558985706, rs748366671, rs142801791, rs571103858, rs377672475, rs368978550, rs1599813671, rs771557284, rs773258112, rs533583599, rs745911237, rs2081014653, rs764926027, rs1201865280, rs2081000124, rs374621936, rs373485975, rs200611081, rs1043558932, rs775719606, rs755223611, rs538230538, rs2081015843, rs548040971, rs1162824119, rs2081015208	RCV001325108 RCV001314034 RCV001318882 RCV001343124 RCV001340385 RCV001367235 RCV001362696 RCV001396518 RCV001410849 RCV001405960 RCV001397485 RCV002070262 RCV001426597 RCV001424281 RCV001443860 RCV001443973 RCV001475069 RCV001463757 RCV001454639 RCV001495311 RCV001486613 RCV002541105 RCV003642980 RCV001900900 RCV001919875 RCV002028540 RCV001904239 RCV001904467 RCV001996583 RCV001966954 RCV001954468 RCV001992743 RCV001999363 RCV002022797 RCV001942658 RCV001979892 RCV001944747 RCV001920101 RCV001892244 RCV001915089 RCV001874161 RCV001916121 RCV002016138 RCV001874776 RCV002031038 RCV001924695 RCV002002465 RCV001938704 RCV002022945 RCV001959848 RCV002006475 RCV001916038 RCV001966793 RCV001906853 RCV001896294 RCV001976991 RCV001886313 RCV001983506 RCV001983958 RCV002167464 RCV002141840 RCV002125499 RCV002104220 RCV002164223 RCV002174133 RCV002150990 RCV002153805 RCV002114418 RCV002082981 RCV002218865 RCV002193100 RCV002116424 RCV002181516 RCV002195063 RCV002199651 RCV002184237 RCV002193985 RCV002304748 RCV002302916 RCV005096510 RCV003094460 RCV003098198 RCV003642998 RCV003103296 RCV003096552 RCV003121006 RCV003643023 RCV003101926 RCV005098194 RCV003528402 RCV002471738 RCV003064963 RCV003063009 RCV003062552 RCV003068258 RCV002664248 RCV002634232 RCV002612260 RCV002624566 RCV002612593 RCV003111844 RCV002587112 RCV002650555 RCV002659194 RCV002721396 RCV002740444 RCV002716597 RCV002736832 RCV002796699 RCV002843597 RCV002872825 RCV002885994 RCV002886177 RCV002904946 RCV002927367 RCV002957303 RCV002914921 RCV002962835 RCV003009767 RCV002999626 RCV003054345 RCV003062066 RCV003040673 RCV003777176 RCV005104197 RCV003528466 RCV003528575 RCV003529063 RCV003529055 RCV003529242 RCV003529386 RCV003529369 RCV003529444 RCV003529264 RCV003529668 RCV003527657 RCV003643324 RCV003643699 RCV003643702 RCV003643747 RCV003642477 RCV003642839 RCV003642830 RCV003827847 RCV003832679 RCV003837321 RCV003875692 RCV005100542 RCV001084941 RCV001080292 RCV000545294 RCV000557852 RCV001079480 RCV000529197 RCV000559966 RCV000547715 RCV001518555 RCV002061984 RCV001518485 RCV002061986 RCV002061985 RCV000632782 RCV000632778 RCV000632781 RCV000632779 RCV000632776 RCV000632780 RCV000632783 RCV000632777 RCV000632775 RCV000632784 RCV000706443 RCV000699125 RCV000702591 RCV000685059 RCV000690644 RCV000706684 RCV000699964 RCV000695645 RCV000697940 RCV000693439 RCV000697539 RCV001352311 RCV000794537 RCV000799889 RCV000824130 RCV000796007 RCV000876369 RCV001423780 RCV000877627 RCV000878196 RCV000873816 RCV000953819 RCV001399350 RCV001464025 RCV001052997 RCV001051854 RCV001059574 RCV001069483 RCV001057323 RCV001044726 RCV001044204 RCV001061868 RCV001863059 RCV005094027 RCV001397494 RCV001203108 RCV001243292 RCV001247330 RCV001315165 RCV001863160 RCV001300366 RCV001303565 RCV001308499
Ovarian serous cystadenocarcinoma	Likely benign	rs764926027	RCV005912465
RRAS-related disorder	Likely benign; Conflicting classifications of pathogenicity; Uncertain significance; Benign	rs765681955, rs375821724, rs766707816, rs544651800, rs199924228, rs149038492, rs745391652, rs749106517, rs766575738, rs2081015859, rs1297251901, rs2513709818, rs571103858, rs781209876, rs2513709734, rs61760904, rs183538580, rs145907892, rs151014532, rs537601977, rs748366671, rs142801791, rs1490597941, rs764926027, rs199675852, rs374621936	RCV004754763 RCV003402044 RCV003893079 RCV003951257 RCV003941330 RCV003916364 RCV003896143 RCV004754903 RCV003928971 RCV003397590 RCV003901169 RCV003931660 RCV003914351 RCV003914588 RCV003914603 RCV003915494 RCV003942742 RCV003925593 RCV003905693 RCV005392302 RCV003895397 RCV003955760 RCV003970605 RCV003938413 RCV003928778 RCV003945910

Associations from Text Mining
Disease Name	Relationship Type	References
Biliary Atresia	Associate	21390152
Carcinogenesis	Associate	28167572
Carcinoma	Associate	19011236
Carcinoma Non Small Cell Lung	Associate	19170230
Carcinoma Pancreatic Ductal	Associate	28167572
Cholangitis	Associate	21390152
Colorectal Neoplasms	Associate	27270312
Endometrial Neoplasms	Associate	20218740
Hyperplasia	Associate	19011236
Jaundice	Associate	21390152
Lung Neoplasms	Stimulate	39326641
Melanoma	Associate	20585650
Neoplasm Metastasis	Associate	20585650
Neoplasms	Associate	19011236
Neurofibrosarcoma	Associate	34530870
Prostatic Neoplasms	Associate	18024597
Stomach Neoplasms	Associate	34584127
Thyroid Cancer Papillary	Associate	39326641
Vascular System Injuries	Associate	19011236