Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6237
Gene name Gene Name - the full gene name approved by the HGNC.	RAS related
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RRAS
Synonyms (NCBI Gene) Gene synonyms aliases	R-Ras, RRAS1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers. [provided

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022156	hsa-miR-124-3p	Microarray	18668037
MIRT025259	hsa-miR-34a-5p	Sequencing	20371350
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT022156	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	24861879
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT731696	hsa-miR-449a	Immunocytochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26381333
MIRT1319469	hsa-miR-124	CLIP-seq
MIRT1319470	hsa-miR-128	CLIP-seq
MIRT1319471	hsa-miR-298	CLIP-seq
MIRT1319472	hsa-miR-34a	CLIP-seq
MIRT1319473	hsa-miR-34c-5p	CLIP-seq
MIRT1319474	hsa-miR-449b	CLIP-seq
MIRT1319475	hsa-miR-506	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2094918	hsa-miR-1343	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2094920	hsa-miR-3192	CLIP-seq
MIRT2094921	hsa-miR-3657	CLIP-seq
MIRT2094922	hsa-miR-3928	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2094924	hsa-miR-4669	CLIP-seq
MIRT2094923	hsa-miR-4501	CLIP-seq
MIRT2393896	hsa-miR-18a	CLIP-seq
MIRT2393897	hsa-miR-18b	CLIP-seq
MIRT2094919	hsa-miR-3120-3p	CLIP-seq
MIRT2393898	hsa-miR-3144-5p	CLIP-seq
MIRT2393899	hsa-miR-3191	CLIP-seq
MIRT2393900	hsa-miR-377	CLIP-seq
MIRT2393901	hsa-miR-4652-5p	CLIP-seq
MIRT1553188	hsa-miR-4733-3p	CLIP-seq
MIRT2393902	hsa-miR-4735-3p	CLIP-seq
MIRT2393903	hsa-miR-4761-5p	CLIP-seq
MIRT2393904	hsa-miR-491-5p	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002521	Process	Leukocyte differentiation	IMP	24705357
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	16773572
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	24705357
GO:0003924	Function	GTPase activity	TAS	3098437
GO:0005515	Function	Protein binding	IPI	17474147, 19843518, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007165	Process	Signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	TAS	3098437
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	22825554
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	IDA	16773572
GO:0019003	Function	GDP binding	IMP	24705357
GO:0036135	Process	Schwann cell migration	IEA
GO:0044877	Function	Protein-containing complex binding	IDA	23209302
GO:0045766	Process	Positive regulation of angiogenesis	IMP	21393242
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	24705357
GO:0060325	Process	Face morphogenesis	IMP	24705357
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070372	Process	Regulation of ERK1 and ERK2 cascade	IMP	24705357
GO:1900148	Process	Negative regulation of Schwann cell migration	IEA
GO:1904906	Process	Positive regulation of endothelial cell-matrix adhesion via fibronectin	IMP	22825554
GO:2001214	Process	Positive regulation of vasculogenesis	IMP	22825554

MIM	HGNC	e!Ensembl
165090	10447	ENSG00000126458

Protein

UniProt ID

P10301

Protein name

Ras-related protein R-Ras (EC 3.6.5.2) (p23)

Protein function

GTP-binding protein with GTPase activity, likely involved in the regulation of MAPK signaling pathway and thereby controlling multiple cellular processes (PubMed:39809765). Regulates the organization of the actin cytoskeleton (PubMed:16537651, P

PDB

2FN4 , 7S0Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	31 → 192	Ras family	Domain

Sequence

MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP
TIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG
KLFTQILRVKDRDDFPVVLVGNKADLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVD
EAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL

Sequence length

218

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway cAMP signaling pathway Phospholipase D signaling pathway Mitophagy - animal Autophagy - animal Cellular senescence Axon guidance Apelin signaling pathway C-type lectin receptor signaling pathway Regulation of actin cytoskeleton Salmonella infection Proteoglycans in cancer		Sema4D mediated inhibition of cell attachment and migration

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
hereditary cancer	Hereditary cancer	N/A	N/A	ClinVar
Hypertension	Hypertension	N/A	N/A	GWAS
Noonan Syndrome	noonan syndrome	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Biliary Atresia	Associate	21390152
Carcinogenesis	Associate	28167572
Carcinoma	Associate	19011236
Carcinoma Non Small Cell Lung	Associate	19170230
Carcinoma Pancreatic Ductal	Associate	28167572
Cholangitis	Associate	21390152
Colorectal Neoplasms	Associate	27270312
Endometrial Neoplasms	Associate	20218740
Hyperplasia	Associate	19011236
Jaundice	Associate	21390152
Lung Neoplasms	Stimulate	39326641
Melanoma	Associate	20585650
Neoplasm Metastasis	Associate	20585650
Neoplasms	Associate	19011236
Neurofibrosarcoma	Associate	34530870
Prostatic Neoplasms	Associate	18024597
Stomach Neoplasms	Associate	34584127
Thyroid Cancer Papillary	Associate	39326641
Vascular System Injuries	Associate	19011236

RRAS (RAS related)