RRAD (RRAD, Ras related glycolysis inhibitor and calcium channel regulator)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6236
Gene name Gene Name - the full gene name approved by the HGNC.
RRAD, Ras related glycolysis inhibitor and calcium channel regulator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RRAD
Synonyms (NCBI Gene) Gene synonyms aliases
RAD, RAD1, REM3
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(184)
miRTarBase ID miRNA Experiments Reference
MIRT019175 hsa-miR-335-5p Microarray 18185580
MIRT454678 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT454677 hsa-miR-764 HITS-CLIP 23824327
MIRT454676 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT672981 hsa-miR-1224-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IEA
GO:0003924 Function GTPase activity TAS 8248782
GO:0005246 Function Calcium channel regulator activity IBA
GO:0005515 Function Protein binding IPI 10359610, 20460530
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
179503 10446 ENSG00000166592
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P55042
Protein name GTP-binding protein RAD (RAD1) (Ras associated with diabetes)
Protein function May regulate basal voltage-dependent L-type Ca(2+) currents and be required for beta-adrenergic augmentation of Ca(2+) influx in cardiomyocytes, thereby regulating increases in heart rate and contractile force (By similarity). May play an import
PDB 2DPX , 2GJS , 3Q72 , 3Q7P , 3Q7Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00071 Ras 93 → 253 Ras family Domain
Tissue specificity TISSUE SPECIFICITY: Most abundantly expressed in the heart. Also found in the skeletal muscle and lung. Lesser amounts in placenta and kidney. Also detected in adipose tissue. Overexpressed in muscle of type II diabetic humans. {ECO:0000269|PubMed:1805652
Sequence 
MTLNGGGSGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAA
AGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEA
EAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDKGSFEKA
SELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNV
QALFEGVVRQIRLRRDSKEANARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSK
SCHDLSVL
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    NGF-stimulated transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Brugada Syndrome Brugada syndrome N/A N/A GenCC
Show/Hide Text Mining Associations (15)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Brugada Syndrome Associate 31114854
Carcinoma Hepatocellular Inhibit 26546438
Carcinoma Non Small Cell Lung Associate 24445599
Carcinoma Squamous Cell Associate 37839873
Diabetes Mellitus Associate 16866878, 8810259
Diabetes Mellitus Type 2 Associate 16511212, 16866878, 7876254
Esophageal Squamous Cell Carcinoma Associate 39891186
Glioblastoma Associate 26506879
Hypoxia Associate 25114038
Lung Neoplasms Inhibit 25114038, 25893381