Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	623
Gene name Gene Name - the full gene name approved by the HGNC.	Bradykinin receptor B1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BDKRB1
Synonyms (NCBI Gene) Gene synonyms aliases	B1BKR, B1R, BKB1R, BKR1, BRADYB1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.2
Summary Summary of gene provided in NCBI Entrez Gene.	Bradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family. Two types of G-protein coupled receptors

Show/Hide all(1)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023170	hsa-miR-124-3p	Microarray	18668037

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
CREB1	Unknown	10842322
ETV4	Unknown	10842322
GATA1	Unknown	10842322
GTF2B	Unknown	15705059
NFKB1	Unknown	15705059
POU1F1	Unknown	10842322
POU2F1	Unknown	10842322
RELA	Unknown	15705059
SP1	Unknown	10842322
TBP	Unknown	15705059
YY1	Unknown	15705059

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004947	Function	Bradykinin receptor activity	IBA
GO:0004947	Function	Bradykinin receptor activity	IDA	1314587, 10422787
GO:0004947	Function	Bradykinin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005783	Component	Endoplasmic reticulum	TAS	9930991
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8063797, 9930991
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8063797
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA

MIM	HGNC	e!Ensembl
600337	1029	ENSG00000100739

Protein

UniProt ID

P46663

Protein name

B1 bradykinin receptor (B1R) (BK-1 receptor)

Protein function

This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.

PDB

7EIB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	54 → 312	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN

Sequence length

353

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction Complement and coagulation cascades Inflammatory mediator regulation of TRP channels Regulation of actin cytoskeleton Pathways in cancer		Peptide ligand-binding receptors G alpha (q) signalling events G alpha (i) signalling events

BDKRB1 (bradykinin receptor B1)