BDKRB1 (bradykinin receptor B1)

Gene

• Entrez ID: 623
• Gene name: Bradykinin receptor B1
• Gene symbol: BDKRB1
• Synonyms (NCBI Gene): B1BKR, B1R, BKB1R, BKR1, BRADYB1
• Chromosome: 14
• Chromosome location: 14q32.2
• Summary: Bradykinin, a 9 aa peptide, is generated in pathophysiologic conditions such as inflammation, trauma, burns, shock, and allergy. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family. Two types of G-protein coupled receptors

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023170	hsa-miR-124-3p	Microarray	18668037

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	10842322
ETV4	Unknown	10842322
GATA1	Unknown	10842322
GTF2B	Unknown	15705059
NFKB1	Unknown	15705059
POU1F1	Unknown	10842322
POU2F1	Unknown	10842322
RELA	Unknown	15705059
SP1	Unknown	10842322
TBP	Unknown	15705059
YY1	Unknown	15705059

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004947	Function	Bradykinin receptor activity	IBA
GO:0004947	Function	Bradykinin receptor activity	IDA	1314587, 10422787
GO:0004947	Function	Bradykinin receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	23597562
GO:0005783	Component	Endoplasmic reticulum	TAS	9930991
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8063797, 9930991
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	8063797
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IEA

Other IDs

• MIM: 600337
• HGNC: 1029
• e!Ensembl: ENSG00000100739

Protein

• UniProt ID: P46663
• Protein name: B1 bradykinin receptor (B1R) (BK-1 receptor)
• Protein function: This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
• PDB: 7EIB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	54 → 312	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
  VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
  LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
  VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
  GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
  AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN

• Sequence length: 353

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Pathways in cancer

Reactome:

Peptide ligand-binding receptors
G alpha (q) signalling events
G alpha (i) signalling events