Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6195
Gene name Gene Name - the full gene name approved by the HGNC.	Ribosomal protein S6 kinase A1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RPS6KA1
Synonyms (NCBI Gene) Gene synonyms aliases	HU-1, MAPKAPK1, MAPKAPK1A, RSK, RSK1, p90Rsk
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) si

Show/Hide all(138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006430	hsa-miR-125b-5p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay	21643012
MIRT006430	hsa-miR-125b-5p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT006430	hsa-miR-125b-5p	ELISA, GFP reporter assay, Immunoblot, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	21643012
MIRT041478	hsa-miR-193b-3p	CLASH	23622248
MIRT722120	hsa-miR-320a	HITS-CLIP	19536157
MIRT722119	hsa-miR-320b	HITS-CLIP	19536157
MIRT722118	hsa-miR-320c	HITS-CLIP	19536157
MIRT722117	hsa-miR-320d	HITS-CLIP	19536157
MIRT722116	hsa-miR-4429	HITS-CLIP	19536157
MIRT722115	hsa-miR-4733-5p	HITS-CLIP	19536157
MIRT722114	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT722113	hsa-miR-4744	HITS-CLIP	19536157
MIRT722112	hsa-miR-4509	HITS-CLIP	19536157
MIRT722111	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT722110	hsa-miR-1301-5p	HITS-CLIP	19536157
MIRT722109	hsa-miR-6502-5p	HITS-CLIP	19536157
MIRT722108	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT722107	hsa-miR-638	HITS-CLIP	19536157
MIRT722106	hsa-miR-6756-5p	HITS-CLIP	19536157
MIRT722105	hsa-miR-6766-5p	HITS-CLIP	19536157
MIRT722104	hsa-miR-4654	HITS-CLIP	19536157
MIRT722103	hsa-miR-4769-5p	HITS-CLIP	19536157
MIRT722102	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT722101	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT006430	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27613090
MIRT722120	hsa-miR-320a	HITS-CLIP	19536157
MIRT722119	hsa-miR-320b	HITS-CLIP	19536157
MIRT722118	hsa-miR-320c	HITS-CLIP	19536157
MIRT722117	hsa-miR-320d	HITS-CLIP	19536157
MIRT722116	hsa-miR-4429	HITS-CLIP	19536157
MIRT722115	hsa-miR-4733-5p	HITS-CLIP	19536157
MIRT722114	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT722113	hsa-miR-4744	HITS-CLIP	19536157
MIRT722112	hsa-miR-4509	HITS-CLIP	19536157
MIRT722111	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT722110	hsa-miR-1301-5p	HITS-CLIP	19536157
MIRT722109	hsa-miR-6502-5p	HITS-CLIP	19536157
MIRT722108	hsa-miR-4713-3p	HITS-CLIP	19536157
MIRT722107	hsa-miR-638	HITS-CLIP	19536157
MIRT722106	hsa-miR-6756-5p	HITS-CLIP	19536157
MIRT722105	hsa-miR-6766-5p	HITS-CLIP	19536157
MIRT722104	hsa-miR-4654	HITS-CLIP	19536157
MIRT722103	hsa-miR-4769-5p	HITS-CLIP	19536157
MIRT722102	hsa-miR-450b-3p	HITS-CLIP	19536157
MIRT722101	hsa-miR-769-3p	HITS-CLIP	19536157
MIRT1318004	hsa-miR-106a	CLIP-seq
MIRT1318005	hsa-miR-106b	CLIP-seq
MIRT1318006	hsa-miR-1245b-3p	CLIP-seq
MIRT1318007	hsa-miR-1253	CLIP-seq
MIRT1318008	hsa-miR-125a-5p	CLIP-seq
MIRT1318009	hsa-miR-125b	CLIP-seq
MIRT1318010	hsa-miR-1343	CLIP-seq
MIRT1318011	hsa-miR-17	CLIP-seq
MIRT1318012	hsa-miR-20a	CLIP-seq
MIRT1318013	hsa-miR-20b	CLIP-seq
MIRT1318014	hsa-miR-2110	CLIP-seq
MIRT1318015	hsa-miR-3157-5p	CLIP-seq
MIRT1318016	hsa-miR-4271	CLIP-seq
MIRT1318017	hsa-miR-4315	CLIP-seq
MIRT1318018	hsa-miR-4319	CLIP-seq
MIRT1318019	hsa-miR-4520a-3p	CLIP-seq
MIRT1318020	hsa-miR-4533	CLIP-seq
MIRT1318021	hsa-miR-4667-5p	CLIP-seq
MIRT1318022	hsa-miR-4691-3p	CLIP-seq
MIRT1318023	hsa-miR-4700-5p	CLIP-seq
MIRT1318024	hsa-miR-4725-3p	CLIP-seq
MIRT1318025	hsa-miR-4747-5p	CLIP-seq
MIRT1318026	hsa-miR-4753-5p	CLIP-seq
MIRT1318027	hsa-miR-4789-5p	CLIP-seq
MIRT1318028	hsa-miR-4790-5p	CLIP-seq
MIRT1318029	hsa-miR-4793-5p	CLIP-seq
MIRT1318030	hsa-miR-519d	CLIP-seq
MIRT1318031	hsa-miR-548t	CLIP-seq
MIRT1318032	hsa-miR-561	CLIP-seq
MIRT1318033	hsa-miR-93	CLIP-seq
MIRT1318034	hsa-miR-3192	CLIP-seq
MIRT1318035	hsa-miR-4314	CLIP-seq
MIRT1318036	hsa-miR-4646-5p	CLIP-seq
MIRT1318037	hsa-miR-4728-3p	CLIP-seq
MIRT1318025	hsa-miR-4747-5p	CLIP-seq
MIRT1318038	hsa-miR-592	CLIP-seq
MIRT1318039	hsa-miR-597	CLIP-seq
MIRT1318040	hsa-miR-628-5p	CLIP-seq
MIRT1318041	hsa-miR-892a	CLIP-seq
MIRT1318042	hsa-miR-943	CLIP-seq
MIRT2094500	hsa-miR-1286	CLIP-seq
MIRT2094501	hsa-miR-214	CLIP-seq
MIRT2094502	hsa-miR-320e	CLIP-seq
MIRT2094503	hsa-miR-3619-5p	CLIP-seq
MIRT2094504	hsa-miR-4436a	CLIP-seq
MIRT2094505	hsa-miR-4530	CLIP-seq
MIRT2094506	hsa-miR-4786-3p	CLIP-seq
MIRT2094507	hsa-miR-671-5p	CLIP-seq
MIRT2094508	hsa-miR-761	CLIP-seq
MIRT2318991	hsa-miR-1226	CLIP-seq
MIRT1318007	hsa-miR-1253	CLIP-seq
MIRT2318992	hsa-miR-1276	CLIP-seq
MIRT2318993	hsa-miR-191	CLIP-seq
MIRT2318994	hsa-miR-28-5p	CLIP-seq
MIRT2318995	hsa-miR-3139	CLIP-seq
MIRT2318996	hsa-miR-3160-3p	CLIP-seq
MIRT2318997	hsa-miR-326	CLIP-seq
MIRT2318998	hsa-miR-330-5p	CLIP-seq
MIRT2318999	hsa-miR-3692	CLIP-seq
MIRT2319000	hsa-miR-4283	CLIP-seq
MIRT2319001	hsa-miR-4293	CLIP-seq
MIRT2319002	hsa-miR-4311	CLIP-seq
MIRT1318017	hsa-miR-4315	CLIP-seq
MIRT2319003	hsa-miR-4489	CLIP-seq
MIRT2094505	hsa-miR-4530	CLIP-seq
MIRT2319004	hsa-miR-4537	CLIP-seq
MIRT1318021	hsa-miR-4667-5p	CLIP-seq
MIRT1318023	hsa-miR-4700-5p	CLIP-seq
MIRT2319005	hsa-miR-4773	CLIP-seq
MIRT1318028	hsa-miR-4790-5p	CLIP-seq
MIRT1318029	hsa-miR-4793-5p	CLIP-seq
MIRT2319006	hsa-miR-583	CLIP-seq
MIRT2319007	hsa-miR-634	CLIP-seq
MIRT2319008	hsa-miR-637	CLIP-seq
MIRT2319009	hsa-miR-708	CLIP-seq
MIRT2319010	hsa-miR-922	CLIP-seq
MIRT2318999	hsa-miR-3692	CLIP-seq
MIRT2614707	hsa-miR-10a	CLIP-seq
MIRT2614708	hsa-miR-10b	CLIP-seq
MIRT2614709	hsa-miR-339-5p	CLIP-seq
MIRT2614710	hsa-miR-3646	CLIP-seq
MIRT2614711	hsa-miR-3667-5p	CLIP-seq
MIRT2614712	hsa-miR-3915	CLIP-seq
MIRT2614713	hsa-miR-3928	CLIP-seq
MIRT2614714	hsa-miR-4725-5p	CLIP-seq
MIRT2614715	hsa-miR-504	CLIP-seq

Show/Hide all(38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10679322, 22357623
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8141249
GO:0004711	Function	Ribosomal protein S6 kinase activity	IBA
GO:0004712	Function	Protein serine/threonine/tyrosine kinase activity	IDA	22797923
GO:0005515	Function	Protein binding	IPI	19470470, 21423205, 22130794, 22939624, 23455922, 23519423, 24189400, 25513777, 29997244, 30126976, 31837246, 31980649, 32814053, 33961781, 34591642, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IMP	35772404
GO:0007165	Process	Signal transduction	TAS	8141249
GO:0007268	Process	Chemical synaptic transmission	TAS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	TAS	18813292
GO:0032007	Process	Negative regulation of TOR signaling	IMP	35772404
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038202	Process	TORC1 signaling	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	18402937
GO:0043066	Process	Negative regulation of apoptotic process	IMP	11684016
GO:0043555	Process	Regulation of translation in response to stress	TAS	18813292
GO:0045202	Component	Synapse	IEA
GO:0045597	Process	Positive regulation of cell differentiation	TAS	18813292
GO:0045893	Process	Positive regulation of DNA-templated transcription	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	22065586
GO:0046872	Function	Metal ion binding	IEA
GO:0072574	Process	Hepatocyte proliferation	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:2000491	Process	Positive regulation of hepatic stellate cell activation	IMP	10679322

MIM	HGNC	e!Ensembl
601684	10430	ENSG00000117676

Protein

UniProt ID

Q15418

Protein name

Ribosomal protein S6 kinase alpha-1 (S6K-alpha-1) (EC 2.7.11.1) (90 kDa ribosomal protein S6 kinase 1) (p90-RSK 1) (p90RSK1) (p90S6K) (MAP kinase-activated protein kinase 1a) (MAPK-activated protein kinase 1a) (MAPKAP kinase 1a) (MAPKAPK-1a) (Ribosomal S6

Protein function

Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through R

PDB

2WNT , 2Z7Q , 2Z7R , 2Z7S , 3RNY , 3TEI , 4H3P , 4NIF , 5CSF , 5CSI , 5CSJ , 5CSN , 5N7D , 5N7F , 5N7G , 5V61 , 5V62 , 6TWY , 7P74 , 7PC8 , 7QQL , 8WF4 , 8XOV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	62 → 321	Protein kinase domain	Domain
PF00433	Pkinase_C	342 → 381	Protein kinase C terminal domain	Family
PF00069	Pkinase	418 → 675	Protein kinase domain	Domain

Sequence

MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPS
HFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVN
HPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHS
LGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHS
HSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRN
PANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTP
KDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYD
DGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSN
ILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSL
GILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDP
HQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESS
ILAQRRVRKLPSTTL

Sequence length

735

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Oocyte meiosis mTOR signaling pathway Thermogenesis Long-term potentiation Neurotrophin signaling pathway Progesterone-mediated oocyte maturation Insulin resistance Yersinia infection Chemical carcinogenesis - receptor activation		ERK/MAPK targets CREB phosphorylation Senescence-Associated Secretory Phenotype (SASP) CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling RSK activation Gastrin-CREB signalling pathway via PKC and MAPK

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Coronary artery disease	Coronary artery disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma Follicular	Associate	39329730
Adenocarcinoma of Lung	Associate	32616892, 32928150, 36254009
Amyotrophic Lateral Sclerosis	Stimulate	31196199
Asthma	Associate	35417913
Breast Neoplasms	Associate	23216670, 24805830, 27028868, 31818359, 32711446, 39218304
Carcinoma Non Small Cell Lung	Associate	28566436
Colorectal Neoplasms	Stimulate	21035469
Colorectal Neoplasms	Associate	34373442
Diabetes Mellitus Type 2	Associate	31932636, 34502231
Ganglioglioma	Associate	24374956
GATA2 Deficiency	Associate	32321919
Glioblastoma	Stimulate	31701625
Glioma	Associate	31701625
Glucosephosphate Dehydrogenase Deficiency	Associate	31476350
Hypoxia	Stimulate	22216126
Inflammation	Associate	21035469
Leukemia Myeloid Acute	Associate	23377826, 34502231, 37462338, 39333927
Lung Neoplasms	Associate	28592245, 32928150
Lung Neoplasms	Stimulate	39329730
Lymphoma Non Hodgkin	Stimulate	31701625
Melanoma	Stimulate	39329730
Microsatellite Instability	Associate	23277013
Neoplasms	Associate	14581487, 21035469, 22212915, 22216126, 23216670, 26053065, 27028868, 28430578, 39329730
Osteoarthritis	Associate	29339024
Pre Eclampsia	Associate	30821550
Precancerous Conditions	Associate	21035469
Sarcoma Kaposi	Associate	28957431
Sezary Syndrome	Associate	26551670
Small Cell Lung Carcinoma	Associate	15613460
Stomach Neoplasms	Associate	33291786
Thyroid cancer medullary	Stimulate	39329730
Triple Negative Breast Neoplasms	Associate	23593654, 27028868, 27049728, 31818359

RPS6KA1 (ribosomal protein S6 kinase A1)