Gene Gene information from NCBI Gene database.
Entrez ID 6194
Gene name Ribosomal protein S6
Gene symbol RPS6
Synonyms (NCBI Gene)
S6eS6
Chromosome 9
Chromosome location 9p22.1
Summary Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic r
miRNA miRNA information provided by mirtarbase database.
246
miRTarBase ID miRNA Experiments Reference
MIRT003330 hsa-miR-15a-5p Review 20026422
MIRT003326 hsa-miR-16-5p Review 20026422
MIRT003326 hsa-miR-16-5p Proteomics 18668040
MIRT051718 hsa-let-7d-5p CLASH 23622248
MIRT048636 hsa-miR-99a-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
53
GO ID Ontology Definition Evidence Reference
GO:0000028 Process Ribosomal small subunit assembly IEA
GO:0002181 Process Cytoplasmic translation IC 23636399
GO:0002181 Process Cytoplasmic translation IDA 8706699, 34314702
GO:0002181 Process Cytoplasmic translation NAS 25901680
GO:0003723 Function RNA binding HDA 22658674
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
180460 10429 ENSG00000137154
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P62753
Protein name Small ribosomal subunit protein eS6 (40S ribosomal protein S6) (Phosphoprotein NP33)
Protein function Component of the 40S small ribosomal subunit (PubMed:23636399, PubMed:8706699). Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA (PubMed:17220279). Part of the s
PDB 4UG0 , 4V6X , 5A2Q , 5AJ0 , 5FLX , 5LKS , 5OA3 , 5T2C , 5VYC , 6F4P , 6F4Q , 6FEC , 6G18 , 6G4S , 6G4W , 6G51 , 6G53 , 6G5H , 6G5I , 6IP5 , 6IP6 , 6IP8 , 6OLE , 6OLF , 6OLG , 6OLI , 6OLZ , 6OM0 , 6OM7 , 6QZP , 6XA1 , 6Y0G , 6Y2L , 6Y57 , 6YBW , 6Z6L , 6Z6M , 6Z6N , 6ZLW , 6ZM7 , 6ZME , 6ZMI , 6ZMO , 6ZMT , 6ZMW , 6ZN5 , 6ZOJ , 6ZOK , 6ZON , 6ZP4 , 6ZUO
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01092 Ribosomal_S6e 1 126 Ribosomal protein S6e Family
Sequence
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKD
IPGLTD
TTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLV
TPRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRAS
TSKSESSQK
Sequence length 249
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
Ribosome
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apelin signaling pathway
Thermogenesis
Insulin signaling pathway
Coronavirus disease - COVID-19
Proteoglycans in cancer
  L13a-mediated translational silencing of Ceruloplasmin expression
mTORC1-mediated signalling
SRP-dependent cotranslational protein targeting to membrane
Viral mRNA Translation
Major pathway of rRNA processing in the nucleolus and cytosol
Translation initiation complex formation
Formation of a pool of free 40S subunits
Formation of the ternary complex, and subsequently, the 43S complex
Ribosomal scanning and start codon recognition
GTP hydrolysis and joining of the 60S ribosomal subunit
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
5
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Gastric cancer Benign rs117840373 RCV005907310
Hemimegalencephaly Uncertain significance rs748611445 RCV000855715
Hepatocellular carcinoma Benign rs117840373 RCV005907308
Malignant lymphoma, large B-cell, diffuse Benign rs117840373 RCV005907309
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 32862831
Anemia Diamond Blackfan Associate 20116044
Angiomyolipoma Associate 16575396
Autism Spectrum Disorder Associate 30705255
Breast Neoplasms Associate 28247844, 29258115
Carcinoma Hepatocellular Associate 24643969
Carcinoma Non Small Cell Lung Associate 24908424, 26490682
Carcinoma Ovarian Epithelial Associate 32862831
Carcinoma Renal Cell Associate 26506236, 28713889
Chondrosarcoma Associate 16779802