Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6150
Gene name	Mitochondrial ribosomal protein L23
Gene symbol	MRPL23
Synonyms (NCBI Gene)	L23MRPRPL23RPL23LuL23m
Chromosome	11
Chromosome location	11p15.5
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039883	hsa-miR-615-3p	CLASH	23622248
MIRT1158904	hsa-miR-103a	CLIP-seq
MIRT1158905	hsa-miR-107	CLIP-seq
MIRT1158906	hsa-miR-1184	CLIP-seq
MIRT1158907	hsa-miR-1207-3p	CLIP-seq
MIRT1158908	hsa-miR-1224-3p	CLIP-seq
MIRT1158909	hsa-miR-1976	CLIP-seq
MIRT1158910	hsa-miR-22	CLIP-seq
MIRT1158911	hsa-miR-3064-3p	CLIP-seq
MIRT1158912	hsa-miR-3178	CLIP-seq
MIRT1158913	hsa-miR-3180	CLIP-seq
MIRT1158914	hsa-miR-3180-3p	CLIP-seq
MIRT1158915	hsa-miR-3196	CLIP-seq
MIRT1158916	hsa-miR-370	CLIP-seq
MIRT1158917	hsa-miR-4279	CLIP-seq
MIRT1158918	hsa-miR-4450	CLIP-seq
MIRT1158919	hsa-miR-451b	CLIP-seq
MIRT1158920	hsa-miR-4632	CLIP-seq
MIRT1158921	hsa-miR-4667-5p	CLIP-seq
MIRT1158922	hsa-miR-4696	CLIP-seq
MIRT1158923	hsa-miR-4700-5p	CLIP-seq
MIRT1158924	hsa-miR-4731-5p	CLIP-seq
MIRT2045540	hsa-miR-1288	CLIP-seq
MIRT1158910	hsa-miR-22	CLIP-seq
MIRT1158911	hsa-miR-3064-3p	CLIP-seq
MIRT2045541	hsa-miR-3194-3p	CLIP-seq
MIRT2045542	hsa-miR-3199	CLIP-seq
MIRT2045543	hsa-miR-4727-5p	CLIP-seq
MIRT2045544	hsa-miR-4769-3p	CLIP-seq
MIRT2045545	hsa-miR-639	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0003723	Function	RNA binding	TAS	8541832
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	TAS	8541832
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005762	Component	Mitochondrial large ribosomal subunit	TAS	8541832
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	TAS	8541832
GO:0032543	Process	Mitochondrial translation	IBA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:0044391	Component	Ribosomal subunit	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
600789	10322	ENSG00000214026

Q16540

Protein name

Large ribosomal subunit protein uL23m (39S ribosomal protein L23, mitochondrial) (L23mt) (MRP-L23) (L23 mitochondrial-related protein) (Ribosomal protein L23-like)

PDB

3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00276	Ribosomal_L23	28 → 107	Ribosomal protein L23	Family

Sequence

MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGI
YNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEG
SAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL

Sequence length

153

Interactions

View interactions

	KEGG		Reactome
	Ribosome		Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	19304784	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	32592379	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Associate	16049284	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	32592379	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	19304784	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	33221763	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPL23 (mitochondrial ribosomal protein L23)