Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6134
Gene name	Ribosomal protein L10
Gene symbol	RPL10
Synonyms (NCBI Gene)	AUTSX5DXS648DXS648EL10MRXS35NOVQMuL16
Chromosome	X
Chromosome location	Xq28
Summary	This gene encodes a ribosomal protein that is a component of the 60S ribosome subunit. The related protein in chicken can bind to c-Jun and can repress c-Jun-mediated transcriptional activation. Some studies have detected an association between variation

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031375	hsa-miR-16-5p	Proteomics	18668040
MIRT051433	hsa-let-7e-5p	CLASH	23622248
MIRT031375	hsa-miR-16-5p	CLASH	23622248
MIRT048579	hsa-miR-100-5p	CLASH	23622248
MIRT044868	hsa-miR-195-5p	CLASH	23622248
MIRT042981	hsa-miR-324-3p	CLASH	23622248
MIRT042981	hsa-miR-324-3p	CLASH	23622248
MIRT041089	hsa-miR-504-5p	CLASH	23622248
MIRT038962	hsa-miR-22-5p	CLASH	23622248
MIRT038172	hsa-miR-423-5p	CLASH	23622248
MIRT037945	hsa-miR-505-5p	CLASH	23622248
MIRT037586	hsa-miR-744-5p	CLASH	23622248
MIRT229448	hsa-miR-496	PAR-CLIP	21572407
MIRT543667	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT543666	hsa-miR-328-5p	PAR-CLIP	21572407
MIRT543665	hsa-miR-6885-5p	PAR-CLIP	21572407
MIRT229452	hsa-miR-4792	PAR-CLIP	21572407
MIRT229451	hsa-miR-4710	PAR-CLIP	21572407
MIRT543664	hsa-miR-8071	PAR-CLIP	21572407
MIRT543663	hsa-miR-3138	PAR-CLIP	21572407
MIRT229450	hsa-miR-4477a	PAR-CLIP	21572407
MIRT543662	hsa-miR-4520-3p	PAR-CLIP	21572407
MIRT229455	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT229448	hsa-miR-496	PAR-CLIP	21572407
MIRT543667	hsa-miR-486-3p	PAR-CLIP	21572407
MIRT543666	hsa-miR-328-5p	PAR-CLIP	21572407
MIRT543665	hsa-miR-6885-5p	PAR-CLIP	21572407
MIRT229452	hsa-miR-4792	PAR-CLIP	21572407
MIRT229451	hsa-miR-4710	PAR-CLIP	21572407
MIRT543664	hsa-miR-8071	PAR-CLIP	21572407
MIRT543663	hsa-miR-3138	PAR-CLIP	21572407
MIRT229450	hsa-miR-4477a	PAR-CLIP	21572407
MIRT543662	hsa-miR-4520-3p	PAR-CLIP	21572407
MIRT229455	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT1315822	hsa-miR-1289	CLIP-seq
MIRT1315823	hsa-miR-1293	CLIP-seq
MIRT1315824	hsa-miR-3122	CLIP-seq
MIRT1315825	hsa-miR-3173-3p	CLIP-seq
MIRT1315826	hsa-miR-3198	CLIP-seq
MIRT1315827	hsa-miR-3689a-3p	CLIP-seq
MIRT1315828	hsa-miR-3689c	CLIP-seq
MIRT1315829	hsa-miR-3913-5p	CLIP-seq
MIRT1315830	hsa-miR-4292	CLIP-seq
MIRT1315831	hsa-miR-4294	CLIP-seq
MIRT1315832	hsa-miR-4300	CLIP-seq
MIRT1315833	hsa-miR-4308	CLIP-seq
MIRT1315834	hsa-miR-4309	CLIP-seq
MIRT1315835	hsa-miR-4421	CLIP-seq
MIRT1315836	hsa-miR-4438	CLIP-seq
MIRT1315837	hsa-miR-4483	CLIP-seq
MIRT1315838	hsa-miR-4488	CLIP-seq
MIRT1315839	hsa-miR-4492	CLIP-seq
MIRT1315840	hsa-miR-4498	CLIP-seq
MIRT1315841	hsa-miR-4505	CLIP-seq
MIRT1315842	hsa-miR-4520a-3p	CLIP-seq
MIRT1315843	hsa-miR-4686	CLIP-seq
MIRT1315844	hsa-miR-4697-5p	CLIP-seq
MIRT1315845	hsa-miR-4731-5p	CLIP-seq
MIRT1315846	hsa-miR-4779	CLIP-seq
MIRT1315847	hsa-miR-624	CLIP-seq
MIRT1315848	hsa-miR-637	CLIP-seq
MIRT1315849	hsa-miR-671-5p	CLIP-seq
MIRT1315850	hsa-miR-762	CLIP-seq
MIRT1315851	hsa-miR-876-3p	CLIP-seq
MIRT1315852	hsa-miR-920	CLIP-seq
MIRT2318425	hsa-miR-1255a	CLIP-seq
MIRT2318426	hsa-miR-1255b	CLIP-seq
MIRT2318427	hsa-miR-125a-3p	CLIP-seq
MIRT2318428	hsa-miR-1324	CLIP-seq
MIRT2318429	hsa-miR-214	CLIP-seq
MIRT2318430	hsa-miR-3619-5p	CLIP-seq
MIRT2318431	hsa-miR-3665	CLIP-seq
MIRT2318432	hsa-miR-4291	CLIP-seq
MIRT2318433	hsa-miR-619	CLIP-seq
MIRT1315849	hsa-miR-671-5p	CLIP-seq
MIRT2318434	hsa-miR-761	CLIP-seq
MIRT2318435	hsa-miR-922	CLIP-seq
MIRT2393869	hsa-miR-1909	CLIP-seq
MIRT2393870	hsa-miR-4468	CLIP-seq
MIRT2458559	hsa-miR-24	CLIP-seq
MIRT2458560	hsa-miR-374a	CLIP-seq
MIRT2458561	hsa-miR-374b	CLIP-seq
MIRT2458562	hsa-miR-4261	CLIP-seq
MIRT2458563	hsa-miR-4284	CLIP-seq
MIRT2458564	hsa-miR-4528	CLIP-seq
MIRT2458565	hsa-miR-494	CLIP-seq
MIRT2458566	hsa-miR-545	CLIP-seq
MIRT2458567	hsa-miR-634	CLIP-seq
MIRT2458559	hsa-miR-24	CLIP-seq
MIRT2458560	hsa-miR-374a	CLIP-seq
MIRT2458561	hsa-miR-374b	CLIP-seq
MIRT2458562	hsa-miR-4261	CLIP-seq
MIRT2458563	hsa-miR-4284	CLIP-seq
MIRT2458564	hsa-miR-4528	CLIP-seq
MIRT2458565	hsa-miR-494	CLIP-seq
MIRT2458566	hsa-miR-545	CLIP-seq
MIRT2458567	hsa-miR-634	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	10508860
GO:0002181	Process	Cytoplasmic translation	IC	23636399
GO:0002181	Process	Cytoplasmic translation	IMP	26290468
GO:0002181	Process	Cytoplasmic translation	NAS	12962325
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IDA	9443083, 23636399
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	IMP	26290468
GO:0003735	Function	Structural constituent of ribosome	NAS	12962325
GO:0005515	Function	Protein binding	IPI	10508860, 16741966, 24965446, 32814053
GO:0005634	Component	Nucleus	IDA	10508860
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005790	Component	Smooth endoplasmic reticulum	IDA	10508860
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IC	9443083
GO:0006412	Process	Translation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0022625	Component	Cytosolic large ribosomal subunit	HDA	12962325
GO:0022625	Component	Cytosolic large ribosomal subunit	IBA
GO:0022625	Component	Cytosolic large ribosomal subunit	IDA	9443083, 26290468
GO:0022625	Component	Cytosolic large ribosomal subunit	IEA
GO:0022626	Component	Cytosolic ribosome	IDA	23636399
GO:0032991	Component	Protein-containing complex	IDA	10508860
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10508860
GO:0045182	Function	Translation regulator activity	IMP	26290468
GO:1990403	Process	Embryonic brain development	IMP	25316788
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
312173	10298	ENSG00000147403

P27635

Protein name

Large ribosomal subunit protein uL16 (60S ribosomal protein L10) (Laminin receptor homolog) (Protein QM) (Ribosomal protein L10) (Tumor suppressor QM)

Protein function

Component of the large ribosomal subunit (PubMed:26290468). Plays a role in the formation of actively translating ribosomes (PubMed:26290468). May play a role in the embryonic brain development (PubMed:25316788). {ECO:0000269|PubMed:25316788, EC

PDB

2PA2 , 5AJ0 , 6OLE , 6OLF , 6OLG , 6OLI , 6OLZ , 6OM0 , 6OM7 , 6W6L , 7F5S , 8A3D , 8FLD , 8FLE , 8FLF , 8G5Y , 8G5Z , 8G60 , 8G61 , 8G6J , 8GLP , 8K2C , 8QFD , 8XSY , 8XSZ , 8YOO , 8YOP , 9C3H , 9GMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00252	Ribosomal_L16	12 → 166	Ribosomal protein L16p/L10e	Family

Sequence

MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGHMVSDEYEQL
SSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINKMLSCAGADRLQTGMRGAFG
KPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADE
FEDMVAEKRLIPDGCGVKYIPNRGPLDKWRALHS

Sequence length

214

Interactions

View interactions

	KEGG		Reactome
	Ribosome Coronavirus disease - COVID-19		L13a-mediated translational silencing of Ceruloplasmin expression SRP-dependent cotranslational protein targeting to membrane Viral mRNA Translation Major pathway of rRNA processing in the nucleolus and cytosol Formation of a pool of free 40S subunits GTP hydrolysis and joining of the 60S ribosomal subunit Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability, X-linked, syndromic, 35	Pathogenic; Likely pathogenic	rs1131692040, rs1131692041, rs1131692042, rs1019534975	RCV000494720 RCV000494718 RCV000494719 RCV001009624

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Autism, susceptibility to, X-linked 5	Uncertain significance; risk factor	rs2522815113, rs387906727, rs782521991	RCV003883287 RCV000022883 RCV000022884
Cholangiocarcinoma	Benign	rs915942	RCV005922533
Malignant lymphoma, large B-cell, diffuse	Benign	rs915942	RCV005922530
Melanoma	Benign	rs915942	RCV005922532
Nonpapillary renal cell carcinoma	Benign	rs915942	RCV005922528
RPL10-related disorder	Uncertain significance	rs2522815696, rs782282641	RCV003399844 RCV003894386
See cases	Uncertain significance	rs2148138570	RCV002252921
Uterine carcinosarcoma	Benign	rs915942	RCV005922531
Uveal melanoma	Benign	rs915942	RCV005922529

Show/Hide Text Mining Associations (18)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Autism Spectrum Disorder	Associate	19166581, 35876338
Autistic Disorder	Associate	19166581
Breast Neoplasms	Associate	37231433
Carcinogenesis	Associate	30172100
Congenital Abnormalities	Associate	35876338
Depression Postpartum	Associate	35876338
Epilepsy	Associate	35876338
Hypertensive Retinopathy	Associate	35876338
Infertility Male	Associate	38012716
Intellectual Disability	Associate	23871722, 35876338
Lymphoma T Cell	Associate	36000950
Lymphoproliferative Syndrome X Linked 2	Associate	35876338
Neoplasms	Inhibit	30172100
Pancreatic Neoplasms	Associate	28388532, 30172100, 37280198
Pancreatitis	Associate	37280198
Prostatic Neoplasms	Associate	32856855
Retinitis	Associate	35876338
Sleep Apnea Obstructive	Associate	34529670

RPL10 (ribosomal protein L10)