CTXN3 (cortexin 3)

Gene

• Entrez ID: 613212
• Gene name: Cortexin 3
• Gene symbol: CTXN3
• Synonyms (NCBI Gene): KABE
• Chromosome: 5
• Chromosome location: 5q23.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT916343	hsa-miR-3065-3p	CLIP-seq
MIRT916344	hsa-miR-4291	CLIP-seq
MIRT1971757	hsa-miR-4503	CLIP-seq
MIRT2207459	hsa-miR-1264	CLIP-seq
MIRT2207460	hsa-miR-3163	CLIP-seq
MIRT2207461	hsa-miR-4279	CLIP-seq
MIRT2207462	hsa-miR-548n	CLIP-seq
MIRT2207463	hsa-miR-548t	CLIP-seq
MIRT2207464	hsa-miR-942	CLIP-seq
MIRT2386590	hsa-miR-3664-3p	CLIP-seq
MIRT2510704	hsa-miR-3614-3p	CLIP-seq
MIRT2510705	hsa-miR-3674	CLIP-seq
MIRT2510706	hsa-miR-4452	CLIP-seq
MIRT2510707	hsa-miR-548a-3p	CLIP-seq
MIRT2510708	hsa-miR-548e	CLIP-seq
MIRT2510709	hsa-miR-548f	CLIP-seq
MIRT2510704	hsa-miR-3614-3p	CLIP-seq
MIRT2510705	hsa-miR-3674	CLIP-seq
MIRT2510706	hsa-miR-4452	CLIP-seq
MIRT2510707	hsa-miR-548a-3p	CLIP-seq
MIRT2510708	hsa-miR-548e	CLIP-seq
MIRT2510709	hsa-miR-548f	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 618746
• HGNC: 31110
• e!Ensembl: ENSG00000205279

Protein

• UniProt ID: Q4LDR2
• Protein name: Cortexin-3 (Kidney and brain-expressed protein)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11057	Cortexin	6 → 81	Cortexin of kidney	Family

• Sequence:

  MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMP
  TSTWADGLEGLEKGQFDHALA

• Sequence length: 81

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations