Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6096
Gene name Gene Name - the full gene name approved by the HGNC.
RAR related orphan receptor B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RORB
Synonyms (NCBI Gene) Gene synonyms aliases
EIG15, NR1F2, ROR-BETA, RORbeta, RZR-BETA, RZRB, bA133M9.1
Disease Acronyms (UniProt) Disease acronyms from UniProt database
EIG15
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q21.13
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of th
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018866 hsa-miR-335-5p Microarray 18185580
MIRT030014 hsa-miR-26b-5p Microarray 19088304
MIRT673000 hsa-miR-6771-3p HITS-CLIP 23824327
MIRT672999 hsa-miR-3675-3p HITS-CLIP 23824327
MIRT672998 hsa-miR-4684-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISS
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601972 10259 ENSG00000198963
Protein
UniProt ID Q92753
Protein name Nuclear receptor ROR-beta (Nuclear receptor RZR-beta) (Nuclear receptor subfamily 1 group F member 2) (Retinoid-related orphan receptor-beta)
Protein function Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Considered to have intrinsic transcriptional activity, have some natural li
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 19 88 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 259 443 Ligand-binding domain of nuclear hormone receptor Domain
Sequence
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSR
DAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQ
SHPEIVNTLFPPLYKELFNPDCATGCK
Sequence length 470
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Circadian rhythm  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Seizure Tonic - clonic seizures rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061
View all (179 more)
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 20864642 ClinVar
Epilepsy epilepsy, idiopathic generalized, susceptibility to, 15, epilepsy, Epilepsy GenCC, GWAS
Neurodevelopmental Disorders complex neurodevelopmental disorder GenCC
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Associate 37734269
Autistic Disorder Associate 25668517
Bipolar Disorder Associate 19839995, 25789810, 25989161
Breast Neoplasms Associate 23822714, 39193850
Carcinoma Squamous Cell Associate 35603384
Cartilage Diseases Associate 36227956
Chromosome 9 duplication 9q21 Associate 37239476
Cognition Disorders Associate 27352968, 28412756
Cytomegalovirus Infections Associate 33432193
Depressive Disorder Associate 25668517