Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6095
Gene name Gene Name - the full gene name approved by the HGNC.
RAR related orphan receptor A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RORA
Synonyms (NCBI Gene) Gene synonyms aliases
IDDECA, NR1F1, ROR1, ROR2, ROR3, RORa1, RORalpha, RZR-ALPHA, RZRA
Disease Acronyms (UniProt) Disease acronyms from UniProt database
IDDECA
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017642 hsa-miR-335-5p Microarray 18185580
MIRT020475 hsa-miR-106b-5p Microarray 17242205
MIRT048959 hsa-miR-92a-3p qRT-PCR 23622248
MIRT048959 hsa-miR-92a-3p CLASH 23622248
MIRT054923 hsa-miR-33b-5p Luciferase reporter assay, qRT-PCR 23716591
Transcription factors
Transcription factor Regulation Reference
HIF1A Activation 14742449
SP1 Activation 14742449
SP3 Activation 14742449
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 19955433
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 21628546
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600825 10258 ENSG00000069667
Protein
UniProt ID P35398
Protein name Nuclear receptor ROR-alpha (Nuclear receptor RZR-alpha) (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)
Protein function Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of embryonic development, cellular differentiation, immunity,
PDB 1N83 , 1S0X , 4S15
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 71 140 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 305 494 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed in a number of tissues. Expressed in both regulatory T-cells (Treg) and effector T-cells (Teff) (PubMed:18354202, PubMed:7916608). Isoform 4: Highly expressed in the central nervous system, including in the cerebellum
Sequence
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSR
DAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAI
YPDIVRLHFPPLYKELFTSEFEPAMQIDG
Sequence length 523
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Th17 cell differentiation
Circadian rhythm
Spinocerebellar ataxia
Inflammatory bowel disease
  RORA activates gene expression
PPARA activates gene expression
Nuclear Receptor transcription pathway
Circadian Clock
SUMOylation of intracellular receptors
Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism Autistic Disorder, Autistic behavior rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699
View all (8 more)
20375269, 21359227
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Gastric cancer Hereditary Diffuse Gastric Cancer rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802
View all (244 more)
16367923
Intellectual developmental disorder with or without epilepsy or cerebellar ataxia INTELLECTUAL DEVELOPMENTAL DISORDER WITH OR WITHOUT EPILEPSY OR CEREBELLAR ATAXIA rs1057518981, rs1555423812, rs1555427498, rs1555427497, rs1595874995, rs1595889010, rs1595874842 29656859
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma, Childhood asthma 29273806, 31619474, 27130862, 30787307, 22561531, 20860503, 30929738, 21907864, 30552067, 27182965, 31036433 ClinVar, GWAS
Head and neck cancer Malignant Head and Neck Neoplasm 29884837 ClinVar
Mental depression Mental Depression, Depressive disorder, Major Depressive Disorder 19693801, 20800221, 22538398 ClinVar
Intellectual Developmental Disorder With Or Without Epilepsy Or Cerebellar Ataxia intellectual developmental disorder with or without epilepsy or cerebellar ataxia GenCC
Associations from Text Mining
Disease Name Relationship Type References
Agoraphobia Associate 24007783
Alzheimer Disease Associate 31283791
Androgen Insensitivity Syndrome Associate 26196693
Arthritis Rheumatoid Associate 25430993
Asthma Associate 23028483, 24260339, 25863981
Autism Spectrum Disorder Associate 24500708
Autism Spectrum Disorder Inhibit 37673435
Autistic Disorder Inhibit 20375269
Autistic Disorder Associate 21359227, 24204716, 24500708, 25668517, 29423132, 37108679
Azoospermia Associate 40215689