Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6093
Gene name Gene Name - the full gene name approved by the HGNC.	Rho associated coiled-coil containing protein kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ROCK1
Synonyms (NCBI Gene) Gene synonyms aliases	P160ROCK, ROCK-I
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q11.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets a

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520015	G>A	Likely-pathogenic	Missense variant, coding sequence variant

Show/Hide all(409)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000945	hsa-miR-146a-5p	flow, Western blot, Northern blot	18174313
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay	18174313
MIRT004047	hsa-miR-584-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21119662
MIRT004047	hsa-miR-584-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21119662
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, qRT-PCR, Western blot	23975506
MIRT053483	hsa-miR-148a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21994419
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25169484
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	25169484
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24465504
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assay	23670799
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, Western blot, qRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assay, Western blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay, Western blot, qRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT054402	hsa-miR-135a-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24465504
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731717	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26474697
MIRT731717	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26474697
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26306811
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26306811
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay, Western blot	26530325
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay, Western blot	26530325
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25065599
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	25065599
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT000945	hsa-miR-146a-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	27221467
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blot	27035227
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blot	27035227
MIRT732668	hsa-miR-136-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33717260
MIRT053076	hsa-miR-335-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31638991
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), In situ hybridization, Microarray, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33168781
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT755857	hsa-miR-448	Luciferase reporter assay, Western blotting, qRT-PCR	35281946
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35127282
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314644	hsa-miR-3126-3p	CLIP-seq
MIRT1314645	hsa-miR-3140-3p	CLIP-seq
MIRT1314646	hsa-miR-3148	CLIP-seq
MIRT1314647	hsa-miR-3171	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT1314650	hsa-miR-337-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314665	hsa-miR-4255	CLIP-seq
MIRT1314666	hsa-miR-4263	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314670	hsa-miR-4490	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314678	hsa-miR-4698	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT1314681	hsa-miR-4774-5p	CLIP-seq
MIRT1314682	hsa-miR-4781-3p	CLIP-seq
MIRT1314683	hsa-miR-4789-5p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT1314689	hsa-miR-508-3p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT1314697	hsa-miR-582-3p	CLIP-seq
MIRT1314698	hsa-miR-605	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT1314701	hsa-miR-875-3p	CLIP-seq
MIRT1314702	hsa-miR-888	CLIP-seq
MIRT2093563	hsa-miR-1244	CLIP-seq
MIRT2093564	hsa-miR-1251	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093567	hsa-miR-150	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT2093569	hsa-miR-224	CLIP-seq
MIRT2093570	hsa-miR-2355-3p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT2093571	hsa-miR-3149	CLIP-seq
MIRT2093572	hsa-miR-3157-5p	CLIP-seq
MIRT2093573	hsa-miR-3160-5p	CLIP-seq
MIRT2093574	hsa-miR-3183	CLIP-seq
MIRT2093575	hsa-miR-325	CLIP-seq
MIRT2093576	hsa-miR-335	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT2093577	hsa-miR-34c-3p	CLIP-seq
MIRT2093578	hsa-miR-3616-5p	CLIP-seq
MIRT2093579	hsa-miR-3647-5p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT2093580	hsa-miR-3909	CLIP-seq
MIRT2093581	hsa-miR-4307	CLIP-seq
MIRT2093582	hsa-miR-431	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2093583	hsa-miR-4646-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT2093584	hsa-miR-4691-3p	CLIP-seq
MIRT2093585	hsa-miR-4696	CLIP-seq
MIRT2093586	hsa-miR-4713-5p	CLIP-seq
MIRT2093587	hsa-miR-4723-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT2093588	hsa-miR-532-3p	CLIP-seq
MIRT2093589	hsa-miR-539	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093593	hsa-miR-548c-3p	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT2093595	hsa-miR-567	CLIP-seq
MIRT2093596	hsa-miR-568	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT2093597	hsa-miR-573	CLIP-seq
MIRT2093598	hsa-miR-579	CLIP-seq
MIRT2093599	hsa-miR-587	CLIP-seq
MIRT2093600	hsa-miR-593	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2093602	hsa-miR-628-3p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2093603	hsa-miR-664	CLIP-seq
MIRT2093604	hsa-miR-676	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT2318106	hsa-miR-3646	CLIP-seq
MIRT2318107	hsa-miR-3663-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT2318109	hsa-miR-4470	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT2318112	hsa-miR-4719	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318113	hsa-miR-4729	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2318116	hsa-miR-4797-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318119	hsa-miR-513b	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2318121	hsa-miR-656	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT2393857	hsa-miR-3680	CLIP-seq
MIRT2393858	hsa-miR-4420	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2613880	hsa-miR-203	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT2613883	hsa-miR-3647-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2613888	hsa-miR-513a-3p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT2613889	hsa-miR-590-3p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2613890	hsa-miR-944	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq

Show/Hide all(103)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA	21873635
GO:0001726	Component	Ruffle	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0004672	Function	Protein kinase activity	TAS	8798490, 10436159
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10652353, 11018042, 18694941, 19036714, 23093407
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	27853422
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10652353, 14660612, 17853893, 20230755, 21281639, 22085929, 23093407, 25416956, 25448675, 27853422, 28514442
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA	21873635
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	ISS
GO:0006468	Process	Protein phosphorylation	IDA	23093407
GO:0006915	Process	Apoptotic process	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12082081
GO:0007165	Process	Signal transduction	TAS	10436159
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007249	Process	I-kappaB kinase/NF-kappaB signaling	IMP	25816133
GO:0007266	Process	Rho protein signal transduction	IBA	21873635
GO:0007266	Process	Rho protein signal transduction	IGI	27160703
GO:0010494	Component	Cytoplasmic stress granule	IBA	21873635
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010506	Process	Regulation of autophagy	TAS	27853422
GO:0010508	Process	Positive regulation of autophagy	IGI	27853422
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IMP	28679962
GO:0010628	Process	Positive regulation of gene expression	IMP	27853422, 28679962
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010951	Process	Negative regulation of endopeptidase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	18573880
GO:0018107	Process	Peptidyl-threonine phosphorylation	IBA	21873635
GO:0019828	Function	Aspartic-type endopeptidase inhibitor activity	IMP	24305806
GO:0022614	Process	Membrane to membrane docking	IDA	12082081
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030334	Process	Regulation of cell migration	IDA	23093407
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA	21873635
GO:0030866	Process	Cortical actin cytoskeleton organization	IGI	25816133
GO:0030866	Process	Cortical actin cytoskeleton organization	IMP	25816133
GO:0031032	Process	Actomyosin structure organization	IBA	21873635
GO:0031175	Process	Neuron projection development	IGI	27160703
GO:0032059	Component	Bleb	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	18573880
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035509	Process	Negative regulation of myosin-light-chain-phosphatase activity	IGI	25816133
GO:0035509	Process	Negative regulation of myosin-light-chain-phosphatase activity	IMP	25816133
GO:0042326	Process	Negative regulation of phosphorylation	ISS
GO:0043312	Process	Neutrophil degranulation	TAS
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	28679962
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0045664	Process	Regulation of neuron differentiation	IGI	27160703
GO:0046872	Function	Metal ion binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048013	Process	Ephrin receptor signaling pathway	TAS
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048598	Process	Embryonic morphogenesis	IBA	21873635
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050900	Process	Leukocyte migration	IDA	12082081
GO:0050901	Process	Leukocyte tethering or rolling	IDA	12082081
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	TAS	27853422
GO:0051451	Process	Myoblast migration	ISS
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IDA	23093407
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA	21873635
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IDA	18573880
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090521	Process	Glomerular visceral epithelial cell migration	ISS
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0106003	Component	Amyloid-beta complex	IDA	27853422
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	IMP	28679962
GO:0140058	Process	Neuron projection arborization	IGI	27160703
GO:1900223	Process	Positive regulation of amyloid-beta clearance	IGI	27853422
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IGI	27160703
GO:1901888	Process	Regulation of cell junction assembly	IBA	21873635
GO:1902003	Process	Regulation of amyloid-beta formation	TAS	27853422
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	24305806, 27853422
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IMP	24305806, 27853422
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905205	Process	Positive regulation of connective tissue replacement	IMP	28679962
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124

MIM	HGNC	e!Ensembl
601702	10251	ENSG00000067900

Protein

UniProt ID

Q13464

Protein name

Rho-associated protein kinase 1 (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-35) (Rho-associated, coiled-coil-containing protein kinase 1) (Rho-associated, coiled-coil-containing protein kinase I) (ROCK-I) (p160 ROCK-1) (p160ROCK)

Protein function

Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved

PDB

1S1C , 2ESM , 2ETK , 2ETR , 2V55 , 3D9V , 3NCZ , 3NDM , 3O0Z , 3TV7 , 3TWJ , 3V8S , 4L2W , 4W7P , 4YVC , 4YVE , 5BML , 5F5P , 5HVU , 5KKS , 5KKT , 5UZJ , 5WNE , 5WNF , 5WNG , 5WNH , 6E9W , 7JOU , 7S25 , 7S26 , 8P0S , 8ZH5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	76 → 338	Protein kinase domain	Domain
PF08912	Rho_Binding	948 → 1014	Rho Binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Detected in blood platelets. {ECO:0000269|PubMed:8617235}.

Sequence

MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS

Sequence length

1354

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway Sphingolipid signaling pathway Vascular smooth muscle contraction TGF-beta signaling pathway Axon guidance Focal adhesion Adherens junction Tight junction Platelet activation Leukocyte transendothelial migration Regulation of actin cytoskeleton Oxytocin signaling pathway Pathogenic Escherichia coli infection Shigellosis Yersinia infection Human cytomegalovirus infection Pathways in cancer Proteoglycans in cancer MicroRNAs in cancer		Apoptotic cleavage of cellular proteins EPHB-mediated forward signaling G alpha (12/13) signalling events Sema4D induced cell migration and growth-cone collapse VEGFA-VEGFR2 Pathway RHO GTPases Activate ROCKs Neutrophil degranulation

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung carcinoma	Carcinoma of lung	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	20140017

Show/Hide Text Mining Associations (108)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Lung Injury	Associate	37052185
Adenocarcinoma of Lung	Associate	36453714
Adenomyosis	Associate	30387365
Breast Neoplasms	Associate	23233531, 26715279, 26758430, 30982494, 31986487, 32729299, 34486491
Carcinogenesis	Stimulate	12508342
Carcinogenesis	Associate	22942252, 26124099, 32154766, 32787581
Carcinoma Hepatocellular	Associate	25804796, 26615424, 30279202, 31117934, 31900116, 32787581, 35287604
Carcinoma Non Small Cell Lung	Associate	22942252, 24633887, 24894676, 30320378, 30873868, 31638991, 32484204, 32554853, 35499228
Carcinoma Non Small Cell Lung	Stimulate	31485605
Carcinoma Ovarian Epithelial	Associate	37820923
Carcinoma Pancreatic Ductal	Associate	26530532
Carcinoma Renal Cell	Associate	21119662, 26066055, 27108693, 29130345
Carcinoma Squamous Cell	Associate	24457551, 25380619
Cardiomyopathies	Stimulate	37852321
Cardiomyopathy Dilated	Stimulate	37852321
Cardiovascular Diseases	Associate	27694793
Cerebral Infarction	Associate	24351102, 29246448
Cholesteatoma	Associate	35177391
Colorectal Neoplasms	Associate	25987767, 26026086, 27159971, 27249601, 34080666, 35101080, 35647190
Corneal Endothelial Cell Loss	Associate	30999892
COVID 19	Associate	36736734
Crohn Disease	Inhibit	29027377
Diabetes Mellitus	Associate	22430126, 26066055, 29768267, 34080666, 36736734
Diabetes Mellitus Type 2	Associate	29768267, 30478982, 36736734
Diabetes Mellitus Type 2	Stimulate	34080666
Diabetic Nephropathies	Associate	35291991
Endometrial Neoplasms	Associate	30387365, 39297944
Esophageal Neoplasms	Associate	12508342
Esophageal Squamous Cell Carcinoma	Associate	36781836
Fibrocartilaginous embolism	Associate	33415745
Fibrosis	Associate	36440854
Glioblastoma	Associate	31515278, 34536977, 35281946
Glioma	Associate	23936026, 25266804, 30915607
Glioma	Stimulate	31083169
Glucocorticoid Receptor Deficiency	Associate	34262023
Heart Defects Congenital	Associate	35737725
Heart Diseases	Associate	26452457, 30999892
Hemorrhagic Stroke	Associate	29246448
Hepatoblastoma	Associate	35179516
Hyperglycemia	Associate	29351188
Hypertension	Associate	22430126, 26066055, 29246448
Hypesthesia	Associate	29593724
Hypoxia	Associate	29351188
Idiopathic Pulmonary Fibrosis	Associate	25358403
Infections	Associate	26819309
Inflammation	Associate	27694793, 32237054, 32252692, 35848968
Kidney Neoplasms	Associate	37683138
Leiomyoma	Associate	32417359
Leprosy	Associate	29593724
Leukemia	Associate	25931586
Leukemia Myeloid Acute	Associate	25931586, 30840284, 36175877
Lung Neoplasms	Inhibit	32554853
Lymphatic Metastasis	Stimulate	23298303, 25755711, 31638991
Lymphatic Metastasis	Associate	24465504, 25380619
Lymphoma Follicular	Associate	24357726
Lymphoma Mantle Cell	Associate	26377148
Melanoma	Associate	25538140
Menorrhagia	Associate	30387365
Metabolic Syndrome	Associate	26004609
Microsatellite Instability	Associate	35474354
Mitochondrial Diseases	Associate	30320378, 31009148, 32554853
Mitral Valve Insufficiency	Associate	25956928
Myopathy with Giant Abnormal Mitochondria	Associate	30999892
Myotonic Dystrophy	Associate	36767649
Nasopharyngeal Carcinoma	Associate	25277193, 31799660, 33336739, 37173390
Neoplasm Metastasis	Associate	16371346, 23056431, 23298303, 24633887, 24894676, 26615424, 26811494, 28205334, 29790629, 30674565, 30840284, 30864107, 30874288, 31799660, 32554853 View all (6 more)
Neoplasm Metastasis	Stimulate	24398981
Neoplasm Metastasis	Inhibit	27311960
Neoplasms	Associate	12733146, 16371346, 21119662, 22430126, 22942252, 23233531, 24398981, 25266804, 25380619, 25755711, 25831237, 26026086, 26615424, 26715279, 27694793 View all (16 more)
Neoplasms	Stimulate	27203208
Neoplasms	Inhibit	30864107, 36077069
Neoplasms Squamous Cell	Associate	31960744
Neuralgia	Associate	29593724
Neuroblastoma	Associate	22382496
Neuroblastoma	Inhibit	25960282
Neurofibrosarcoma	Associate	34530870
Obesity	Inhibit	23948067
Osteoporosis	Associate	37683138
Osteosarcoma	Associate	21387396, 24398981, 24801908, 30674565, 32660450, 32963586
Ovarian Neoplasms	Associate	16371346, 21459799, 29642915, 29790629
Pain	Associate	29593724
Pancreatic Neoplasms	Associate	22232555, 36077069, 37164685
Personality Disorders	Associate	30285776
Prostatic Neoplasms	Associate	28184030, 31210296, 31557128
Prostatic Neoplasms Castration Resistant	Associate	18174313
Pulmonary Disease Chronic Obstructive	Associate	22913419
Pulmonary Fibrosis	Associate	25358403
Rectal Neoplasms	Associate	26458302
Respiratory Distress Syndrome	Associate	27269648
Retinal Dysplasia	Associate	23298303
Retinoblastoma	Associate	24528629
Rhabdomyosarcoma	Associate	20956521
Sarcoma Ewing	Associate	28112365, 29270775
Sepsis	Associate	37052185
Sleep Apnea Obstructive	Inhibit	29475915
Small Cell Lung Carcinoma	Associate	34271873
Spinal Muscular Atrophies of Childhood	Associate	32558393
Squamous Cell Carcinoma of Head and Neck	Associate	25755711, 30364063
Stomach Neoplasms	Associate	23298303, 24465504, 25169484, 26811494, 31115002, 32679742
Tauopathies	Associate	40545554
Tetralogy of Fallot	Associate	23782575
Thyroid Cancer Papillary	Associate	31696481
Triple Negative Breast Neoplasms	Associate	32729299
Trisomy 18 Syndrome	Associate	21152935
Urinary Bladder Neoplasms	Associate	23056431, 24180482, 35127282
Uterine Cervical Neoplasms	Associate	24457551, 31939597, 37486699
Vascular Diseases	Associate	30999892
Vulvar Neoplasms	Associate	25380619

ROCK1 (Rho associated coiled-coil containing protein kinase 1)