Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6092
Gene name Gene Name - the full gene name approved by the HGNC.	Roundabout guidance receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ROBO2
Synonyms (NCBI Gene) Gene synonyms aliases	SAX3
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the ROBO family, part of the immunoglobulin superfamily of proteins that are highly conserved from fly to human. The encoded protein is a transmembrane receptor for the slit homolog 2 protein and functions in ax

Show/Hide all(3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs267607014	T>C	Pathogenic	Coding sequence variant, missense variant
rs267607015	G>A,C	Pathogenic	Coding sequence variant, missense variant
rs754279676	G>A	Likely-pathogenic	5 prime UTR variant, coding sequence variant, missense variant

Show/Hide all(69)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005809	hsa-miR-145-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, western blot	21276775
MIRT005809	hsa-miR-145-5p	Reporter assay	21276775
MIRT038206	hsa-miR-342-5p	CLASH	23622248
MIRT541770	hsa-miR-8084	PAR-CLIP	21572407
MIRT541769	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT541768	hsa-miR-4801	PAR-CLIP	21572407
MIRT541767	hsa-miR-6844	PAR-CLIP	21572407
MIRT541766	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT541765	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT541770	hsa-miR-8084	PAR-CLIP	21572407
MIRT541769	hsa-miR-4731-3p	PAR-CLIP	21572407
MIRT541768	hsa-miR-4801	PAR-CLIP	21572407
MIRT541767	hsa-miR-6844	PAR-CLIP	21572407
MIRT541766	hsa-miR-514a-3p	PAR-CLIP	21572407
MIRT541765	hsa-miR-514b-3p	PAR-CLIP	21572407
MIRT1314590	hsa-miR-1305	CLIP-seq
MIRT1314591	hsa-miR-205	CLIP-seq
MIRT1314592	hsa-miR-2278	CLIP-seq
MIRT1314593	hsa-miR-23a	CLIP-seq
MIRT1314594	hsa-miR-23b	CLIP-seq
MIRT1314595	hsa-miR-23c	CLIP-seq
MIRT1314596	hsa-miR-297	CLIP-seq
MIRT1314597	hsa-miR-3149	CLIP-seq
MIRT1314598	hsa-miR-338-5p	CLIP-seq
MIRT1314599	hsa-miR-33a	CLIP-seq
MIRT1314600	hsa-miR-33b	CLIP-seq
MIRT1314601	hsa-miR-380	CLIP-seq
MIRT1314602	hsa-miR-4279	CLIP-seq
MIRT1314603	hsa-miR-4682	CLIP-seq
MIRT1314604	hsa-miR-4711-3p	CLIP-seq
MIRT1314605	hsa-miR-4720-5p	CLIP-seq
MIRT1314606	hsa-miR-4799-3p	CLIP-seq
MIRT1314607	hsa-miR-511	CLIP-seq
MIRT1314608	hsa-miR-513a-3p	CLIP-seq
MIRT1314609	hsa-miR-567	CLIP-seq
MIRT1314610	hsa-miR-582-5p	CLIP-seq
MIRT1314611	hsa-miR-587	CLIP-seq
MIRT1314612	hsa-miR-646	CLIP-seq
MIRT1314613	hsa-miR-654-3p	CLIP-seq
MIRT1314614	hsa-miR-155	CLIP-seq
MIRT1314615	hsa-miR-208a	CLIP-seq
MIRT1314616	hsa-miR-208b	CLIP-seq
MIRT1314617	hsa-miR-4432	CLIP-seq
MIRT1314618	hsa-miR-448	CLIP-seq
MIRT1314619	hsa-miR-499-5p	CLIP-seq
MIRT1314620	hsa-miR-622	CLIP-seq
MIRT2093556	hsa-miR-1911	CLIP-seq
MIRT2093557	hsa-miR-4474-3p	CLIP-seq
MIRT2093558	hsa-miR-4762-3p	CLIP-seq
MIRT2093559	hsa-miR-580	CLIP-seq
MIRT1314618	hsa-miR-448	CLIP-seq
MIRT2318092	hsa-miR-1267	CLIP-seq
MIRT2318093	hsa-miR-141	CLIP-seq
MIRT2318094	hsa-miR-200a	CLIP-seq
MIRT1314597	hsa-miR-3149	CLIP-seq
MIRT2318095	hsa-miR-345	CLIP-seq
MIRT2318096	hsa-miR-3913-3p	CLIP-seq
MIRT2318097	hsa-miR-4652-3p	CLIP-seq
MIRT2318098	hsa-miR-489	CLIP-seq
MIRT2318099	hsa-miR-514	CLIP-seq
MIRT2393856	hsa-miR-3688-3p	CLIP-seq
MIRT1314602	hsa-miR-4279	CLIP-seq
MIRT1314608	hsa-miR-513a-3p	CLIP-seq
MIRT2093556	hsa-miR-1911	CLIP-seq
MIRT2458501	hsa-miR-4539	CLIP-seq
MIRT2458502	hsa-miR-4724-5p	CLIP-seq
MIRT2093556	hsa-miR-1911	CLIP-seq
MIRT2458501	hsa-miR-4539	CLIP-seq
MIRT2458502	hsa-miR-4724-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001656	Process	Metanephros development	ISS
GO:0001657	Process	Ureteric bud development	IMP	17357069
GO:0003129	Process	Heart induction	ISS
GO:0003148	Process	Outflow tract septum morphogenesis	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003184	Process	Pulmonary valve morphogenesis	ISS
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0005515	Function	Protein binding	IPI	12504588, 15207848, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0006935	Process	Chemotaxis	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	12504588
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007411	Process	Axon guidance	ISS
GO:0007417	Process	Central nervous system development	NAS	9458045
GO:0007420	Process	Brain development	IEA
GO:0007420	Process	Brain development	IEP	10197527
GO:0008046	Function	Axon guidance receptor activity	ISS
GO:0008046	Function	Axon guidance receptor activity	NAS	9458045
GO:0009986	Component	Cell surface	IDA	12504588
GO:0016020	Component	Membrane	IEA
GO:0016199	Process	Axon midline choice point recognition	ISS
GO:0021891	Process	Olfactory bulb interneuron development	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030673	Component	Axolemma	ISS
GO:0031290	Process	Retinal ganglion cell axon guidance	ISS
GO:0032870	Process	Cellular response to hormone stimulus	IEP	18566128
GO:0035295	Process	Tube development	IEA
GO:0035904	Process	Aorta development	ISS
GO:0042802	Function	Identical protein binding	IDA	12504588
GO:0045747	Process	Positive regulation of Notch signaling pathway	ISS
GO:0050772	Process	Positive regulation of axonogenesis	IDA	12504588
GO:0050772	Process	Positive regulation of axonogenesis	IEA
GO:0050925	Process	Negative regulation of negative chemotaxis	IDA	11748139
GO:0050925	Process	Negative regulation of negative chemotaxis	IEA
GO:0051964	Process	Negative regulation of synapse assembly	ISS
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0061364	Process	Apoptotic process involved in luteolysis	IEP	18566128
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098609	Process	Cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
602431	10250	ENSG00000185008

Protein

UniProt ID

Q9HCK4

Protein name

Roundabout homolog 2

Protein function

Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal

PDB

1UEM , 1UJT , 2EDJ , 5NOI , 6I9S , 6IAA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	30 → 114		Domain
PF07679	I-set	133 → 221	Immunoglobulin I-set domain	Domain
PF07679	I-set	225 → 310	Immunoglobulin I-set domain	Domain
PF07679	I-set	314 → 408	Immunoglobulin I-set domain	Domain
PF07679	I-set	418 → 505	Immunoglobulin I-set domain	Domain
PF00041	fn3	523 → 607	Fibronectin type III domain	Domain
PF00041	fn3	640 → 724	Fibronectin type III domain	Domain
PF00041	fn3	738 → 826	Fibronectin type III domain	Domain

Sequence

MSLLMFTQLLLCGFLYVRVDGSRLRQEDFPPRIVEHPSDVIVSKGEPTTLNCKAEGRPTP
TIEWYKDGERVETDKDDPRSHRMLLPSGSLFFLRIVHGRRSKPDEGSYVCVARNYLGEAV
SRNASLEVALLRDDFRQNPTDVVVAAGEPAILECQPPRGHPEPTIYWKKDKVRIDDKEER
ISIRGGKLMISNTRKSDAGMYTCVGTNMVGERDSDPAELTVFERPTFLRRPINQVVLEEE
AVEFRCQVQGDPQPTVRWKKDDADLPRGRYDIKDDYTLRIKKTMSTDEGTYMCIAENRVG
KMEASATLTVRAPPQFVVRPRDQIVAQGRTVTFPCETKGNPQPAVFWQKEGSQNLLFPNQ
PQQPNSRCSVSPTGDLTITNIQRSDAGYYICQALTVAGSILAKAQLEVTDVLTDRPPPII
LQGPANQTLAVDGTALLKCKATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRI
SDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
SWQPGTPGTLPASAYIIEAFSQSVSNSWQTVANHVKTTLYTVRGLRPNTIYLFMVRAINP
QGLSDPSPMSDPVRTQDISPPAQGVDHRQVQKELGDVLVRLHNPVVLTPTTVQVTWTVDR
QPQFIQGYRVMYRQTSGLQATSSWQNLDAKVPTERSAVLVNLKKGVTYEIKVRPYFNEFQ
GMDSESKTVRTTEEAPSAPPQSVTVLTVGSYNSTSISVSWDPPPPDHQNGIIQEYKIWCL
GNETRFHINKTVDAAIRSVIIGGLFPGIQYRVEVAASTSAGVGVKSEPQPIIIGRRNEVV
ITENNNSITEQITDVVKQPAFIAGIGGACWVILMGFSIWLYWRRKKRKGLSNYAVTFQRG
DGGLMSNGSRPGLLNAGDPSYPWLADSWPATSLPVNNSNSGPNEIGNFGRGDVLPPVPGQ
GDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQW
KSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWANVPLPPPPVQ
PLPGTELEHYAVEQQENGYDSDSWCPPLPVQTYLHQGLEDELEEDDDRVPTPPVRGVASS
PAISFGQQSTATLTPSPREEMQPMLQAHLDELTRAYQFDIAKQTWHIQSNNQPPQPPVPP
LGYVSGALISDLETDVADDDADDEEEALEIPRPLRALDQTPGSSMDNLDSSVTGKAFTSS
QRPRPTSPFSTDSNTSAALSQSQRPRPTKKHKGGRMDQQPALPHRREGMTDEEALVPYSK
PSFPSPGGHSSSGTASSKGSTGPRKTEVLRAGHQRNASDLLDIGYMGSNSQGQFTGEL

Sequence length

1378

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		Signaling by ROBO receptors Regulation of commissural axon pathfinding by SLIT and ROBO

Show/Hide Unknown Diseases (10)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Congenital anomalies of kidney and urinary tract	Congenital anomaly of kidney and urinary tract	N/A	N/A	ClinVar
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Lung adenocarcinoma	Familial lung adenocarcinoma	N/A	N/A	GWAS
Metabolic Syndrome	Bitter taste perception (6-n-propylthiouracil) in obesity with metabolic syndrome, Metabolic syndrome	N/A	N/A	GWAS
Restless Legs Syndrome	Restless legs syndrome	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS
Vesicoureteral Reflux	vesicoureteral reflux 2, familial vesicoureteral reflux	N/A	N/A	ClinVar, GenCC
vesicoureteral reflux	Vesicoureteral reflux	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Aphasia	Associate	38181310
Attention Deficit Disorder with Hyperactivity	Associate	17010153
Auditory Perceptual Disorders	Associate	17010153
Autistic Disorder	Associate	25226531
Cakut	Associate	18235093, 24429398
Carcinogenesis	Associate	22719878, 22968929, 27461616
Carcinoma Hepatocellular	Associate	19114000, 38297025
Cardiomyopathies	Associate	36508697
Cholangiocarcinoma	Associate	27009864, 33468537
Colorectal Neoplasms	Associate	22968929
Congenital Abnormalities	Associate	32041992
Congenital Microtia	Associate	35584116
Depressive Disorder	Associate	32681239
Developmental Disabilities	Associate	32973238
Diabetic Nephropathies	Associate	20634963
Disruptive Impulse Control and Conduct Disorders	Associate	17010153
Dyslexia	Associate	25226531
Hairy Ears	Associate	35584116
Heart Failure	Associate	36508697
Idiopathic Pulmonary Fibrosis	Associate	31640794
Kidney Diseases	Associate	20634963
Leukemia Myeloid Acute	Associate	28220884, 30820596
Leukemia T Cell	Associate	26608094
Liver Cirrhosis	Associate	38297025
Lymphoma Large B Cell Diffuse	Associate	23531283
Motor Disorders	Associate	38181310
Mouth Diseases	Associate	22719878
Myelodysplastic Syndromes	Associate	26608094
Neoplasm Invasiveness	Associate	22719878
Neoplasms	Associate	22719878, 33810183, 36011316, 36508697, 38297025
Neoplasms	Inhibit	23531283, 24272677
Ovarian Neoplasms	Inhibit	22132142
Pain	Associate	32681239
Pancreatic Neoplasms	Associate	38297025
Periodontitis	Associate	34732256
Prostatic Neoplasms	Associate	24272677
Speech Sound Disorder	Associate	25226531
Stomach Neoplasms	Associate	27461616
Thalamic Diseases	Associate	38382530
Urinary Bladder Neoplasms	Associate	38073378
Uterine Cervical Diseases	Associate	22719878
Uterine Cervical Dysplasia	Associate	22719878
Uterine Cervical Neoplasms	Associate	36011316
Vesico Ureteral Reflux	Associate	15829711, 18235093, 22558067, 23536131, 32041992

ROBO2 (roundabout guidance receptor 2)