Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	60678
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic elongation factor, selenocysteine-tRNA specific
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EEFSEC
Synonyms (NCBI Gene) Gene synonyms aliases	EFSEC, NEDPSB, SELB
Disease Acronyms (UniProt) Disease acronyms from UniProt database	NEDPSB
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q21.3

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments	Reference
MIRT041486	hsa-miR-193b-3p	CLASH	23622248
MIRT953396	hsa-miR-122	CLIP-seq
MIRT953397	hsa-miR-1293	CLIP-seq
MIRT953398	hsa-miR-1909	CLIP-seq
MIRT953399	hsa-miR-3135b	CLIP-seq
MIRT953400	hsa-miR-3652	CLIP-seq
MIRT953401	hsa-miR-3944-5p	CLIP-seq
MIRT953402	hsa-miR-4430	CLIP-seq
MIRT953403	hsa-miR-4483	CLIP-seq
MIRT953404	hsa-miR-4492	CLIP-seq
MIRT953405	hsa-miR-4498	CLIP-seq
MIRT953406	hsa-miR-574-5p	CLIP-seq
MIRT953407	hsa-miR-648	CLIP-seq
MIRT953408	hsa-miR-762	CLIP-seq
MIRT953409	hsa-miR-765	CLIP-seq
MIRT1982289	hsa-miR-1275	CLIP-seq
MIRT1982290	hsa-miR-4447	CLIP-seq
MIRT1982291	hsa-miR-4453	CLIP-seq
MIRT1982292	hsa-miR-4472	CLIP-seq
MIRT1982293	hsa-miR-4488	CLIP-seq
MIRT1982294	hsa-miR-4505	CLIP-seq
MIRT1982295	hsa-miR-4538	CLIP-seq
MIRT1982296	hsa-miR-4651	CLIP-seq
MIRT1982297	hsa-miR-4665-5p	CLIP-seq
MIRT1982298	hsa-miR-4697-5p	CLIP-seq
MIRT1982299	hsa-miR-608	CLIP-seq
MIRT2217089	hsa-miR-3190	CLIP-seq
MIRT2217090	hsa-miR-34a	CLIP-seq
MIRT2217091	hsa-miR-34c-5p	CLIP-seq
MIRT2217092	hsa-miR-3675-5p	CLIP-seq
MIRT2217093	hsa-miR-449a	CLIP-seq
MIRT2217094	hsa-miR-449b	CLIP-seq
MIRT2217095	hsa-miR-486-3p	CLIP-seq
MIRT2217096	hsa-miR-7	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0001514	Process	Selenocysteine incorporation	IBA	21873635
GO:0003746	Function	Translation elongation factor activity	IBA	21873635
GO:0003924	Function	GTPase activity	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006414	Process	Translational elongation	IBA	21873635
GO:0035368	Function	Selenocysteine insertion sequence binding	IEA
GO:0043021	Function	Ribonucleoprotein complex binding	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
607695	24614	ENSG00000132394

Protein

UniProt ID

P57772

Protein name

Selenocysteine-specific elongation factor (EC 3.6.5.-) (Elongation factor sec) (Eukaryotic elongation factor, selenocysteine-tRNA-specific)

Protein function

Translation factor required for the incorporation of the rare amino acid selenocysteine encoded by UGA codons (PubMed:27708257, PubMed:35709277). Replaces the eRF1-eRF3-GTP ternary complex for the insertion of selenocysteine directed by the UGA

PDB

5IZK , 5IZL , 5IZM , 7ZJW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00009	GTP_EFTU	5 → 315	Elongation factor Tu GTP binding domain	Domain

Sequence

MAGRRVNVNVGVLGHIDSGKTALARALSTTASTAAFDKQPQSRERGITLDLGFSCFSVPL
PARLRSSLPEFQAAPEAEPEPGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVT
KGMQTQSAECLVIGQIACQKLVVVLNKIDLLPEGKRQAAIDKMTKKMQKTLENTKFRGAP
IIPVAAKPGGPEAPETEAPQGIPELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTV
MTGTILSGSISLGDSVEIPALKVVKKVKSMQMFHMPITSAMQGDRLGICVTQFDPKLLER
GLVCAPESLHTVHAALISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDNFDQ
EPILDSFNFSQEYLFQEQYLSKDLTPAVTDNDEADKKAGQATEGHCPRQQWALVEFEKPV
TCPRLCLVIGSRLDADIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKLKHKHGLVE
RAMDDYSVIGRSLFKKETNIQLFVGLKVHLSTGELGIIDSAFGQSGKFKIHIPGGLSPES
KKILTPALKKRARAGRGEATRQEESAERSEPSQHVVLSLTFKRYVFDTHKRMVQSP

Sequence length

596

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Endometrial carcinoma	Endometrial Carcinoma	rs34612342, rs587776667, rs587776701, rs63750955, rs587776706, rs121434629, rs80359605, rs121913530, rs104894365, rs79184941, rs121913478, rs63750781, rs193922343, rs267608094, rs267608077 View all (247 more)	30093612
Prostate cancer	Malignant neoplasm of prostate, Prostate carcinoma	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	19767754, 29892016

Show/Hide Unknown Diseases (7)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma, Childhood asthma		30929738	ClinVar, GWAS
Chronic obstructive pulmonary disease	Chronic Obstructive Airway Disease		30940143, 30804561, 28166215	ClinVar
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	20512145	ClinVar, CBGDA
Schizophrenia	Schizophrenia			GWAS
Hypospadias	Hypospadias			GWAS
Diabetes	Diabetes			GWAS
Uterine Fibroids	Uterine Fibroids			GWAS

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Cerebellar Diseases	Associate	40652205
Coronary Artery Disease	Associate	30587704
Developmental Disabilities	Associate	40652205
Endometrial Neoplasms	Associate	34675350
Genetic Diseases Inborn	Associate	40652205
Periodontitis	Associate	37466550
Prostatic Neoplasms	Associate	19767754, 22077888, 26068399
Pulmonary Disease Chronic Obstructive	Associate	29313708
Takayasu Arteritis	Associate	27769046

EEFSEC (eukaryotic elongation factor, selenocysteine-tRNA specific)