Gene Gene information from NCBI Gene database.
Entrez ID 6059
Gene name ATP binding cassette subfamily E member 1
Gene symbol ABCE1
Synonyms (NCBI Gene)
ABC38OABPRLIRLI1RNASEL1RNASELIRNS4I
Chromosome 4
Chromosome location 4q31.21
Summary The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, M
miRNA miRNA information provided by mirtarbase database.
437
miRTarBase ID miRNA Experiments Reference
MIRT004713 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004713 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004713 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT004713 hsa-miR-203a-3p Luciferase reporter assayqRT-PCRWestern blot 19843643
MIRT030495 hsa-miR-24-3p Microarray 19748357
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
40
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003924 Function GTPase activity IDA 20122402
GO:0005506 Function Iron ion binding IBA
GO:0005515 Function Protein binding IPI 7539425, 16275648, 25944354, 32296183, 35271311
GO:0005524 Function ATP binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
601213 69 ENSG00000164163
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P61221
Protein name ATP-binding cassette sub-family E member 1 (EC 3.6.5.-) (2'-5'-oligoadenylate-binding protein) (HuHP68) (RNase L inhibitor) (Ribonuclease 4 inhibitor) (RNS4I)
Protein function Nucleoside-triphosphatase (NTPase) involved in ribosome recycling by mediating ribosome disassembly (PubMed:20122402, PubMed:21448132). Able to hydrolyze ATP, GTP, UTP and CTP (PubMed:20122402). Splits ribosomes into free 60S subunits and tRNA-
PDB 6ZME , 6ZVJ , 7A09
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04068 RLI 6 37 Possible Fer4-like domain in RNase L inhibitor, RLI Family
PF00037 Fer4 48 71 4Fe-4S binding domain Domain
PF00005 ABC_tran 100 245 ABC transporter Domain
PF00005 ABC_tran 362 490 ABC transporter Domain
Sequence
MADKLTRIAIVNHDKCKPKKCRQECKKSCPVVRMGKLCIEVTPQSKIAWISETLCIGCGI
CIKKCPFGALS
IVNLPSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTAL
KILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAA
KGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMF
DEPSS
YLDVKQRLKAAITIRSLINPDRYIIVVEHDLSVLDYLSDFICCLYGVPSAYGVVT
MPFSVREGINIFLDGYVPTENLRFRDASLVFKVAETANEEEVKKMCMYKYPGMKKKMGEF
ELAIVAGEFTDSEIMVMLGENGTGKTTFIRMLAGRLKPDEGGEVPVLNVSYKPQKISPKS
TGSVRQLLHEKIRDAYTHPQFVTDVMKPLQIENIIDQEVQTLSGGELQRVALALCLGKPA
DVYLIDEPSA
YLDSEQRLMAARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPS
KNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD
Sequence length 599
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    OAS antiviral response
Interferon alpha/beta signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920849 RCV000149039
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 22267055, 29145194
Breast Neoplasms Stimulate 25070080
Carcinogenesis Associate 31306106
Communicable Diseases Associate 19657357
Diabetic Cardiomyopathies Associate 30246236
Esophageal Neoplasms Associate 24551278, 25815591
Fatigue Syndrome Chronic Associate 36284352
HIV Infections Associate 19657357, 9847332
Iron Deficiencies Associate 33023155
Lung Neoplasms Associate 26617714, 29145194, 31306106