Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
60528
Gene name Gene Name - the full gene name approved by the HGNC.
ElaC ribonuclease Z 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ELAC2
Synonyms (NCBI Gene) Gene synonyms aliases
COXPD17, ELC2, HPC2
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene has a C-terminal domain with tRNA 3′ processing endoribonuclease activity, which catalyzes the removal of the 3` trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) an
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs4792311 G>A,C Pathogenic, benign Coding sequence variant, missense variant, intron variant
rs5030739 C>T Pathogenic, benign Coding sequence variant, missense variant
rs119484086 C>A,T Pathogenic, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs119484087 T>A,C Pathogenic, benign Coding sequence variant, missense variant
rs149733287 T>C Conflicting-interpretations-of-pathogenicity Intron variant, splice acceptor variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT031823 hsa-miR-16-5p Proteomics 18668040
MIRT048960 hsa-miR-92a-3p CLASH 23622248
MIRT048834 hsa-miR-93-5p CLASH 23622248
MIRT047119 hsa-miR-183-5p CLASH 23622248
MIRT042299 hsa-miR-484 CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0004518 Function Nuclease activity IEA
GO:0004519 Function Endonuclease activity IEA
GO:0004521 Function RNA endonuclease activity TAS
GO:0004549 Function TRNA-specific ribonuclease activity EXP 12711671, 15317868, 16361254, 18809514, 21559454, 21593607
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605367 14198 ENSG00000006744
Protein
UniProt ID Q9BQ52
Protein name Zinc phosphodiesterase ELAC protein 2 (EC 3.1.26.11) (ElaC homolog protein 2) (Heredity prostate cancer protein 2) (Ribonuclease Z 2) (RNase Z 2) (tRNA 3 endonuclease 2) (tRNase Z 2)
Protein function Zinc phosphodiesterase, which displays mitochondrial tRNA 3'-processing endonuclease activity. Involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA (PubMed:21593607). Associates with mitochondrial DNA complexes at the nucleo
PDB 8CBL , 8RR1 , 8RR3 , 8RR4 , 8Z0P , 8Z1F , 8Z1G , 9EY0 , 9EY1 , 9EY2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13691 Lactamase_B_4 61 120 tRNase Z endonuclease Domain
PF12706 Lactamase_B_2 510 725 Beta-lactamase superfamily domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highly expressed in heart, placenta, liver, skeletal muscle, kidney, pancreas, testis and ovary. Weakly expressed in brain, lung, spleen, thymus, prostate, small intestine, colon and leukocytes. {ECO:0000269|PubMed:11
Sequence
MWALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYL
QVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKLKVARLDNIFLTRMHWSNVGG
LSGMILTLKETGLPKCVLSGPPQLEKYLEAIKIFSGPLKGIELAVRPHSAPEYEDETMTV
YQIPIHSEQRRGKHQPWQSPERPLSRLSPERSSDSESNENEPHLPHGVSQRRGVRDSSLV
VAFICKLHLKRGNFLVLKAKEMGLPVGTAAIAPIIAAVKDGKSITHEGREILAEELCTPP
DPGAAFVVVECPDESFIQPICENATFQRYQGKADAPVALVVHMAPASVLVDSRYQQWMER
FGPDTQHLVLNENCASVHNLRSHKIQTQLNLIHPDIFPLLTSFRCKKEGPTLSVPMVQGE
CLLKYQLRPRREWQRDAIITCNPEEFIVEALQLPNFQQSVQEYRRSAQDGPAPAEKRSQY
PEIIFLGTGSAIPMKIRNVSATLVNISPDTSLLLDCGEGTFGQLCRHYGDQVDRVLGTLA
AVFVSHLHADHHTGLPSILLQRERALASLGKPLHPLLVVAPNQLKAWLQQYHNQCQEVLH
HISMIPAKCLQEGAEISSPAVERLISSLLRTCDLEEFQTCLVRHCKHAFGCALVHTSGWK
VVYSGDTMPCEALVRMGKDATLLIHEATLEDGLEEEAVEKTHSTTSQAISVGMRMNAEFI
MLNHF
SQRYAKVPLFSPNFSEKVGVAFDHMKVCFGDFPTMPKLIPPLKALFAGDIEEMEE
RREKRELRQVRAALLSRELAGGLEDGEPQQKRAHTEEPQAKKVRAQ
Sequence length 826
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    tRNA processing in the nucleus
tRNA processing in the mitochondrion
rRNA processing in the mitochondrion
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Combined Oxidative Phosphorylation Deficiency combined oxidative phosphorylation defect type 17 rs397515465, rs397515466, rs1060502161, rs763770476, rs761385155, rs1555575927, rs1555576642, rs1308121771, rs387906327, rs1567773277, rs397515463, rs374954001, rs397515464 N/A
Prostate Cancer, Hereditary prostate cancer, hereditary, 2 rs387906327 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Microcephaly microcephaly N/A N/A ClinVar
Mitochondrial Diseases mitochondrial disease N/A N/A GenCC
ovarian cancer Ovarian cancer N/A N/A ClinVar
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acidosis Lactic Associate 31045291
Cap Myopathy Associate 10986046
Carcinogenesis Associate 31045291
Carcinoma Hepatocellular Associate 29209123
Cardiomyopathy Hypertrophic Associate 23849775, 27769300, 31045291
Head and Neck Neoplasms Associate 34635145
Heart Diseases Associate 27769300
Hemorrhage Associate 37889747
Intellectual Disability Associate 27769300
Mitochondrial complex I deficiency Associate 23849775, 27769300