Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	60490
Gene name	Phosphopantothenoylcysteine decarboxylase
Gene symbol	PPCDC
Synonyms (NCBI Gene)	MDS018PPC-DCcoaC
Chromosome	15
Chromosome location	15q24.2
Summary	Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC (EC 4.1.1.36), one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopante

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments
MIRT1252246	hsa-miR-1256	CLIP-seq
MIRT1252247	hsa-miR-1976	CLIP-seq
MIRT1252248	hsa-miR-224	CLIP-seq
MIRT1252249	hsa-miR-2682	CLIP-seq
MIRT1252250	hsa-miR-3120-5p	CLIP-seq
MIRT1252251	hsa-miR-3128	CLIP-seq
MIRT1252252	hsa-miR-3132	CLIP-seq
MIRT1252253	hsa-miR-3146	CLIP-seq
MIRT1252254	hsa-miR-320a	CLIP-seq
MIRT1252255	hsa-miR-320b	CLIP-seq
MIRT1252256	hsa-miR-320c	CLIP-seq
MIRT1252257	hsa-miR-320d	CLIP-seq
MIRT1252258	hsa-miR-320e	CLIP-seq
MIRT1252259	hsa-miR-326	CLIP-seq
MIRT1252260	hsa-miR-330-5p	CLIP-seq
MIRT1252261	hsa-miR-4252	CLIP-seq
MIRT1252262	hsa-miR-4429	CLIP-seq
MIRT1252263	hsa-miR-4487	CLIP-seq
MIRT1252264	hsa-miR-4496	CLIP-seq
MIRT1252265	hsa-miR-449c	CLIP-seq
MIRT1252266	hsa-miR-4675	CLIP-seq
MIRT1252267	hsa-miR-4688	CLIP-seq
MIRT1252268	hsa-miR-4720-5p	CLIP-seq
MIRT1252269	hsa-miR-4741	CLIP-seq
MIRT1252270	hsa-miR-4757-5p	CLIP-seq
MIRT1252271	hsa-miR-4761-3p	CLIP-seq
MIRT1252272	hsa-miR-4799-3p	CLIP-seq
MIRT1252273	hsa-miR-563	CLIP-seq
MIRT1252274	hsa-miR-626	CLIP-seq
MIRT1252275	hsa-miR-628-3p	CLIP-seq
MIRT1252276	hsa-miR-885-3p	CLIP-seq
MIRT1252277	hsa-miR-940	CLIP-seq
MIRT2074305	hsa-miR-3622b-5p	CLIP-seq
MIRT2301281	hsa-miR-1184	CLIP-seq
MIRT2301282	hsa-miR-1285	CLIP-seq
MIRT2301283	hsa-miR-153	CLIP-seq
MIRT2301284	hsa-miR-3187-5p	CLIP-seq
MIRT2301285	hsa-miR-3614-5p	CLIP-seq
MIRT2301286	hsa-miR-448	CLIP-seq
MIRT2301287	hsa-miR-4662a-3p	CLIP-seq
MIRT2301288	hsa-miR-4691-3p	CLIP-seq
MIRT2301289	hsa-miR-4764-5p	CLIP-seq
MIRT2301290	hsa-miR-505	CLIP-seq
MIRT2301291	hsa-miR-592	CLIP-seq
MIRT2301292	hsa-miR-597	CLIP-seq
MIRT2301293	hsa-miR-612	CLIP-seq
MIRT2301294	hsa-miR-668	CLIP-seq
MIRT2301282	hsa-miR-1285	CLIP-seq
MIRT2597980	hsa-miR-145	CLIP-seq
MIRT2597981	hsa-miR-150	CLIP-seq
MIRT2597982	hsa-miR-2278	CLIP-seq
MIRT2597983	hsa-miR-24	CLIP-seq
MIRT2597984	hsa-miR-2861	CLIP-seq
MIRT2597985	hsa-miR-3155	CLIP-seq
MIRT2597986	hsa-miR-3155b	CLIP-seq
MIRT2597987	hsa-miR-3157-5p	CLIP-seq
MIRT2301284	hsa-miR-3187-5p	CLIP-seq
MIRT2597988	hsa-miR-331-3p	CLIP-seq
MIRT2597989	hsa-miR-361-3p	CLIP-seq
MIRT2597990	hsa-miR-3661	CLIP-seq
MIRT2597991	hsa-miR-3925-3p	CLIP-seq
MIRT2597992	hsa-miR-4254	CLIP-seq
MIRT2597993	hsa-miR-4267	CLIP-seq
MIRT2597994	hsa-miR-4291	CLIP-seq
MIRT2597995	hsa-miR-4292	CLIP-seq
MIRT2597996	hsa-miR-4297	CLIP-seq
MIRT2597997	hsa-miR-4650-5p	CLIP-seq
MIRT2597998	hsa-miR-4690-5p	CLIP-seq
MIRT2301288	hsa-miR-4691-3p	CLIP-seq
MIRT2597999	hsa-miR-4694-5p	CLIP-seq
MIRT2598000	hsa-miR-4738-3p	CLIP-seq
MIRT2598001	hsa-miR-4786-5p	CLIP-seq
MIRT2598002	hsa-miR-484	CLIP-seq
MIRT2598003	hsa-miR-490-3p	CLIP-seq
MIRT2598004	hsa-miR-545	CLIP-seq
MIRT2301293	hsa-miR-612	CLIP-seq
MIRT2598005	hsa-miR-619	CLIP-seq
MIRT2598006	hsa-miR-631	CLIP-seq
MIRT2598007	hsa-miR-649	CLIP-seq
MIRT2598008	hsa-miR-766	CLIP-seq
MIRT2598009	hsa-miR-769-5p	CLIP-seq
MIRT2688417	hsa-miR-1228	CLIP-seq
MIRT2301282	hsa-miR-1285	CLIP-seq
MIRT2597980	hsa-miR-145	CLIP-seq
MIRT2688418	hsa-miR-148a	CLIP-seq
MIRT2688419	hsa-miR-148b	CLIP-seq
MIRT2597981	hsa-miR-150	CLIP-seq
MIRT2688420	hsa-miR-152	CLIP-seq
MIRT2597982	hsa-miR-2278	CLIP-seq
MIRT2688421	hsa-miR-2355-5p	CLIP-seq
MIRT2597983	hsa-miR-24	CLIP-seq
MIRT2597984	hsa-miR-2861	CLIP-seq
MIRT2597985	hsa-miR-3155	CLIP-seq
MIRT2597986	hsa-miR-3155b	CLIP-seq
MIRT2597987	hsa-miR-3157-5p	CLIP-seq
MIRT2301284	hsa-miR-3187-5p	CLIP-seq
MIRT2597988	hsa-miR-331-3p	CLIP-seq
MIRT2597989	hsa-miR-361-3p	CLIP-seq
MIRT2597990	hsa-miR-3661	CLIP-seq
MIRT2597991	hsa-miR-3925-3p	CLIP-seq
MIRT2597992	hsa-miR-4254	CLIP-seq
MIRT2597993	hsa-miR-4267	CLIP-seq
MIRT2597994	hsa-miR-4291	CLIP-seq
MIRT2597995	hsa-miR-4292	CLIP-seq
MIRT2597996	hsa-miR-4297	CLIP-seq
MIRT2688422	hsa-miR-4330	CLIP-seq
MIRT2597997	hsa-miR-4650-5p	CLIP-seq
MIRT2597998	hsa-miR-4690-5p	CLIP-seq
MIRT2301288	hsa-miR-4691-3p	CLIP-seq
MIRT2688423	hsa-miR-4717-3p	CLIP-seq
MIRT2598000	hsa-miR-4738-3p	CLIP-seq
MIRT2598001	hsa-miR-4786-5p	CLIP-seq
MIRT2598002	hsa-miR-484	CLIP-seq
MIRT2598003	hsa-miR-490-3p	CLIP-seq
MIRT2598004	hsa-miR-545	CLIP-seq
MIRT2301293	hsa-miR-612	CLIP-seq
MIRT2598005	hsa-miR-619	CLIP-seq
MIRT2598006	hsa-miR-631	CLIP-seq
MIRT2598007	hsa-miR-649	CLIP-seq
MIRT2598008	hsa-miR-766	CLIP-seq
MIRT2598009	hsa-miR-769-5p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003824	Function	Catalytic activity	IEA
GO:0004633	Function	Phosphopantothenoylcysteine decarboxylase activity	EXP	15581364
GO:0004633	Function	Phosphopantothenoylcysteine decarboxylase activity	IBA
GO:0004633	Function	Phosphopantothenoylcysteine decarboxylase activity	IDA	11923312, 15581364
GO:0004633	Function	Phosphopantothenoylcysteine decarboxylase activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0010181	Function	FMN binding	IBA
GO:0010181	Function	FMN binding	IDA	14501115
GO:0015937	Process	Coenzyme A biosynthetic process	IBA
GO:0015937	Process	Coenzyme A biosynthetic process	IDA	11923312
GO:0015937	Process	Coenzyme A biosynthetic process	IEA
GO:0015937	Process	Coenzyme A biosynthetic process	TAS
GO:0016829	Function	Lyase activity	IEA
GO:0016831	Function	Carboxy-lyase activity	IEA
GO:0042802	Function	Identical protein binding	IDA	14501115
GO:0042802	Function	Identical protein binding	IPI	25416956, 26514574, 32296183
GO:0071513	Component	Phosphopantothenoylcysteine decarboxylase complex	IBA

MIM	HGNC	e!Ensembl
609854	28107	ENSG00000138621

Q96CD2

Protein name

Phosphopantothenoylcysteine decarboxylase (PPC-DC) (EC 4.1.1.36) (CoaC)

Protein function

Catalyzes the decarboxylation of the cysteine moiety of 4-phosphopantothenoylcysteine to form 4'-phosphopantotheine and this reaction forms part of the biosynthesis of coenzyme A.

PDB

1QZU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02441	Flavoprotein	18 → 195	Flavoprotein	Family

Sequence

MEPKASCPAAAPLMERKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVTTERAKHFY
SPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLVAPLDANTLGKVASGICDNLL
TCVMRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIPCVAKKLVCGDEGLGA
MAEVGTIVDKVKEVLFQHSGFQQS

Sequence length

204

Interactions

View interactions

	KEGG		Reactome
	Pantothenate and CoA biosynthesis Metabolic pathways Biosynthesis of cofactors		Coenzyme A biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMENORRHEA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Amenorrhea	Associate	31371054	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Associate	29482039	★★★★★ ★☆☆☆☆ Found in Text Mining only

PPCDC (phosphopantothenoylcysteine decarboxylase)