Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	60487
Gene name Gene Name - the full gene name approved by the HGNC.	TRNA methyltransferase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TRMT11
Synonyms (NCBI Gene) Gene synonyms aliases	C6orf75, MDS024, TRM11, TRMT11-1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6q22.32

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029017	hsa-miR-26b-5p	Microarray	19088304
MIRT2136868	hsa-miR-23a	CLIP-seq
MIRT2136869	hsa-miR-23b	CLIP-seq
MIRT2136870	hsa-miR-23c	CLIP-seq
MIRT2357652	hsa-miR-3674	CLIP-seq
MIRT2357653	hsa-miR-410	CLIP-seq
MIRT2357654	hsa-miR-4699-3p	CLIP-seq
MIRT2651326	hsa-miR-153	CLIP-seq
MIRT2651327	hsa-miR-302f	CLIP-seq
MIRT2651328	hsa-miR-3065-5p	CLIP-seq
MIRT2651329	hsa-miR-338-3p	CLIP-seq
MIRT2651330	hsa-miR-3646	CLIP-seq
MIRT2651331	hsa-miR-369-3p	CLIP-seq
MIRT2651332	hsa-miR-374a	CLIP-seq
MIRT2651333	hsa-miR-374b	CLIP-seq
MIRT2651334	hsa-miR-4307	CLIP-seq
MIRT2651335	hsa-miR-448	CLIP-seq
MIRT2651336	hsa-miR-4530	CLIP-seq
MIRT2651337	hsa-miR-505	CLIP-seq
MIRT2651338	hsa-miR-548aa	CLIP-seq
MIRT2651339	hsa-miR-548ac	CLIP-seq
MIRT2651340	hsa-miR-548d-3p	CLIP-seq
MIRT2651341	hsa-miR-548n	CLIP-seq
MIRT2651342	hsa-miR-548t	CLIP-seq
MIRT2651343	hsa-miR-548z	CLIP-seq
MIRT2651344	hsa-miR-549	CLIP-seq
MIRT2651345	hsa-miR-606	CLIP-seq
MIRT2651346	hsa-miR-922	CLIP-seq
MIRT2651326	hsa-miR-153	CLIP-seq
MIRT2651327	hsa-miR-302f	CLIP-seq
MIRT2651329	hsa-miR-338-3p	CLIP-seq
MIRT2651330	hsa-miR-3646	CLIP-seq
MIRT2651331	hsa-miR-369-3p	CLIP-seq
MIRT2651332	hsa-miR-374a	CLIP-seq
MIRT2651333	hsa-miR-374b	CLIP-seq
MIRT2651335	hsa-miR-448	CLIP-seq
MIRT2651336	hsa-miR-4530	CLIP-seq
MIRT2651338	hsa-miR-548aa	CLIP-seq
MIRT2651339	hsa-miR-548ac	CLIP-seq
MIRT2651340	hsa-miR-548d-3p	CLIP-seq
MIRT2651343	hsa-miR-548z	CLIP-seq
MIRT2651344	hsa-miR-549	CLIP-seq
MIRT2651345	hsa-miR-606	CLIP-seq

Show/Hide all(7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000049	Function	TRNA binding	IEA
GO:0004809	Function	TRNA (guanine-N2-)-methyltransferase activity	EXP	15899842
GO:0004809	Function	TRNA (guanine-N2-)-methyltransferase activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0008168	Function	Methyltransferase activity	IBA	21873635
GO:0030488	Process	TRNA methylation	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein

UniProt ID

Q7Z4G4

Protein name

tRNA (guanine(10)-N(2))-methyltransferase TRMT11 (EC 2.1.1.214) (tRNA methyltransferase 11 homolog)

Protein function

Catalytic subunit of the TRMT11-TRM112 methyltransferase complex, that specifically mediates the S-adenosyl-L-methionine-dependent N(2)-methylation of guanosine nucleotide at position 10 (m2G10) in tRNAs (PubMed:37283053). This is one of the maj

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01170	UPF0020	189 → 326	Putative RNA methylase family UPF0020	Domain

Sequence

MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIA
RNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLT
QEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQR
ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYV
YGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPSWRKGT
YFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFA
AETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE

Sequence length

463

Interactions

View interactions

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	30705370
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	30705370
Colonic neoplasms	Malignant tumor of colon, Colonic Neoplasms	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483	30705370
Esophagus neoplasm	Esophageal Neoplasms, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	30705370
Glioblastoma	Glioblastoma, Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888	30705370
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	30705370
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	30705370
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)	30705370

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Leprosy	Leprosy			GWAS

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	30705370
Breast Neoplasms	Associate	30705370
Carcinoma Hepatocellular	Associate	30705370
Carcinoma Non Small Cell Lung	Associate	30705370
Colorectal Neoplasms	Associate	30705370
Common Variable Immunodeficiency	Associate	36220400
Death	Associate	25238935
Glioblastoma	Associate	30705370
Neoplasm Metastasis	Associate	25238935
Neoplasms	Associate	30705370
Ovarian Neoplasms	Associate	30705370
Prostatic Neoplasms	Associate	22386179, 25238935, 34417538

TRMT11 (tRNA methyltransferase 11)