TRMT11 (tRNA methyltransferase 11)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
60487
Gene name Gene Name - the full gene name approved by the HGNC.
TRNA methyltransferase 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TRMT11
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf75, MDS024, TRM11, TRMT11-1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q22.32
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(43)
miRTarBase ID miRNA Experiments Reference
MIRT029017 hsa-miR-26b-5p Microarray 19088304
MIRT2136868 hsa-miR-23a CLIP-seq
MIRT2136869 hsa-miR-23b CLIP-seq
MIRT2136870 hsa-miR-23c CLIP-seq
MIRT2357652 hsa-miR-3674 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000049 Function TRNA binding IEA
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0005515 Function Protein binding IPI 32296183, 33961781, 34948388
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z4G4
Protein name tRNA (guanine(10)-N(2))-methyltransferase TRMT11 (EC 2.1.1.214) (tRNA methyltransferase 11 homolog)
Protein function Catalytic subunit of the TRMT11-TRM112 methyltransferase complex, that specifically mediates the S-adenosyl-L-methionine-dependent N(2)-methylation of guanosine nucleotide at position 10 (m2G10) in tRNAs (PubMed:37283053). This is one of the maj
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01170 UPF0020 189 → 326 Putative RNA methylase family UPF0020 Domain
Sequence 
MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIA
RNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLT
QEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQR
ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYV
YGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPSWRKGT
YFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFA
AETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE
Sequence length 463
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Leprosy Leprosy N/A N/A GWAS
Show/Hide Text Mining Associations (12)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 30705370
Breast Neoplasms Associate 30705370
Carcinoma Hepatocellular Associate 30705370
Carcinoma Non Small Cell Lung Associate 30705370
Colorectal Neoplasms Associate 30705370
Common Variable Immunodeficiency Associate 36220400
Death Associate 25238935
Glioblastoma Associate 30705370
Neoplasm Metastasis Associate 25238935
Neoplasms Associate 30705370