Gene Gene information from NCBI Gene database.
Entrez ID 6047
Gene name Ring finger protein 4
Gene symbol RNF4
Synonyms (NCBI Gene)
RES4-26SLX5SNURF
Chromosome 4
Chromosome location 4p16.3
Summary The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription
miRNA miRNA information provided by mirtarbase database.
1120
miRTarBase ID miRNA Experiments Reference
MIRT020102 hsa-miR-361-5p Sequencing 20371350
MIRT024183 hsa-miR-221-3p Sequencing 20371350
MIRT050699 hsa-miR-18a-5p CLASH 23622248
MIRT050642 hsa-miR-19a-3p CLASH 23622248
MIRT046803 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003677 Function DNA binding ISS
GO:0004842 Function Ubiquitin-protein transferase activity ISS
GO:0005515 Function Protein binding IPI 10713105, 12885770, 20212317, 28842558, 32296183
GO:0005634 Component Nucleus IDA 12885770
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602850 10067 ENSG00000063978
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78317
Protein name E3 ubiquitin-protein ligase RNF4 (EC 2.3.2.27) (RING finger protein 4) (Small nuclear ring finger protein) (Protein SNURF)
Protein function E3 ubiquitin-protein ligase which binds polysumoylated chains covalently attached to proteins and mediates 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination of those substrates and their subsequent targeting to the proteasome
PDB 2EA6 , 2XEU , 4PPE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 131 176 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed at low levels in many tissues; highly expressed in testis. {ECO:0000269|PubMed:9479498}.
Sequence
MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVD
LTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEG
ATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKI
NHKRYHPIYI
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Processing of DNA double-strand break ends
Antigen processing: Ubiquitination & Proteasome degradation