Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6047
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF4
Synonyms (NCBI Gene) Gene synonyms aliases
RES4-26, SLX5, SNURF
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING finger motif and acts as a transcription regulator. This protein has been shown to interact with, and inhibit the activity of, TRPS1, a transcription suppressor of GATA-mediated transcription. Transcription
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020102 hsa-miR-361-5p Sequencing 20371350
MIRT024183 hsa-miR-221-3p Sequencing 20371350
MIRT050699 hsa-miR-18a-5p CLASH 23622248
MIRT050642 hsa-miR-19a-3p CLASH 23622248
MIRT046803 hsa-miR-222-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding ISS
GO:0004842 Function Ubiquitin-protein transferase activity ISS
GO:0005515 Function Protein binding IPI 10713105, 12885770, 20212317, 28842558, 32296183
GO:0005634 Component Nucleus IDA 12885770
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602850 10067 ENSG00000063978
Protein
UniProt ID P78317
Protein name E3 ubiquitin-protein ligase RNF4 (EC 2.3.2.27) (RING finger protein 4) (Small nuclear ring finger protein) (Protein SNURF)
Protein function E3 ubiquitin-protein ligase which binds polysumoylated chains covalently attached to proteins and mediates 'Lys-6'-, 'Lys-11'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination of those substrates and their subsequent targeting to the proteasome
PDB 2EA6 , 2XEU , 4PPE
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13923 zf-C3HC4_2 131 176 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed at low levels in many tissues; highly expressed in testis. {ECO:0000269|PubMed:9479498}.
Sequence
MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVD
LTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEG
ATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKI
NHKRYHPIYI
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Processing of DNA double-strand break ends
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Colonic neoplasms Malignant tumor of colon rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483 29228715
Colorectal cancer Colorectal Carcinoma, Adenocarcinoma of large intestine rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
29228715
Colorectal neoplasms Colorectal Neoplasms, Malignant neoplasm of large intestine rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
29228715
Unknown
Disease term Disease name Evidence References Source
Huntington disease Huntington Disease 22387017 ClinVar
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 27072586
Breast Neoplasms Associate 27653698
Carcinogenesis Associate 35926659, 36153321
Carcinoma Non Small Cell Lung Associate 27418131
Cholangiocarcinoma Stimulate 35926659
Colonic Neoplasms Associate 27653698
Endometrial Neoplasms Associate 36047377
Fanconi Anemia Associate 25751062
Huntington Disease Associate 9734812
Leiomyosarcoma Associate 36153321