Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
6046
Gene name Gene Name - the full gene name approved by the HGNC.
Bromodomain containing 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BRD2
Synonyms (NCBI Gene) Gene synonyms aliases
BRD2-IT1, D6S113E, FSH, FSHRG1, FSRG1, NAT, O27.1.1, RING3, RNF3
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052027 hsa-let-7b-5p CLASH 23622248
MIRT051807 hsa-let-7c-5p CLASH 23622248
MIRT049226 hsa-miR-92a-3p CLASH 23622248
MIRT049226 hsa-miR-92a-3p CLASH 23622248
MIRT047023 hsa-miR-204-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
BRD7 Activation 12600283
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin IDA 17848202, 20048151, 20709061
GO:0001843 Process Neural tube closure IEA
GO:0003682 Function Chromatin binding IBA
GO:0004674 Function Protein serine/threonine kinase activity IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601540 1103 ENSG00000204256
Protein
UniProt ID P25440
Protein name Bromodomain-containing protein 2 (O27.1.1)
Protein function Chromatin reader protein that specifically recognizes and binds histone H4 acetylated at 'Lys-5' and 'Lys-12' (H4K5ac and H4K12ac, respectively), thereby controlling gene expression and remodeling chromatin structures (PubMed:17148447, PubMed:17
PDB 1X0J , 2DVQ , 2DVR , 2DVS , 2DVV , 2E3K , 2G4A , 2YDW , 2YEK , 3AQA , 3ONI , 4A9E , 4A9F , 4A9H , 4A9I , 4A9J , 4A9M , 4A9N , 4A9O , 4AKN , 4ALG , 4ALH , 4J1P , 4MR5 , 4MR6 , 4QEU , 4QEV , 4QEW , 4UYF , 4UYG , 4UYH , 5BT5 , 5DFB , 5DFC , 5DFD , 5DW1 , 5EK9 , 5HEL , 5HEM , 5HEN , 5HFQ , 5IBN , 5IG6 , 5N2L , 5O38 , 5O39 , 5O3A , 5O3B , 5O3C , 5O3D , 5O3E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00439 Bromodomain 83 168 Bromodomain Domain
PF00439 Bromodomain 353 441 Bromodomain Domain
PF17035 BET 641 705 Bromodomain extra-terminal - transcription regulation Domain
Sequence
MLQNVTPHNKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLTPAN
PPPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQT
LEKIFLQKVASM
PQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNI
PHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPA
SPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKEL
LSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL
MFSNCYKYNPPDHDVVAMARK
LQDVFEFRYAKMPDEPLEPGPLPVSTAMPPGLAKSSSES
SSEESSSESSSEEEEEEDEEDEEEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQG
PISKPKRKREKKEKKKKRKAEKHRGRAGADEDDKGPRAPRPPQPKKSKKASGSGGGSAAL
GPSGFGPSGGSGTKLPKKATKTAPPALPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGE
KLGRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLS
CLRKKPRKPYTIKKP
VGKTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKANEKTESSSAQQVAVSRLSASSSS
SDSSSSSSSSSSSDTSDSDSG
Sequence length 801
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RUNX3 regulates p14-ARF
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Nonatopic asthma, Asthma (adult onset), Asthma N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Oligodendroglioma Oligodendroglioma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 21608014
Adrenocortical Carcinoma Associate 36793283
Aphasia Broca Associate 36818472
Arthritis Rheumatoid Associate 27898717, 33717143
Azoospermia Associate 32860660
Bipolar Disorder Associate 33168801
Breast Neoplasms Associate 15743503, 25001387, 30952871, 33099470
Carcinoma Ovarian Epithelial Associate 31043489
Carcinoma Pancreatic Ductal Associate 28096419
Colitis Ulcerative Associate 28008999