CDH26 (cadherin 26)

Gene

• Entrez ID: 60437
• Gene name: Cadherin 26
• Gene symbol: CDH26
• Synonyms (NCBI Gene): VR20
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: This gene encodes a member of the cadherin protein family. Cadherins are a family of calcium-dependent adhesion molecules that mediate cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization, migration

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2465075	hsa-miR-3129-3p	CLIP-seq
MIRT2465076	hsa-miR-330-3p	CLIP-seq
MIRT2465077	hsa-miR-4422	CLIP-seq
MIRT2465078	hsa-miR-4760-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0005178	Function	Integrin binding	IDA	28051089
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28051089
GO:0005886	Component	Plasma membrane	IDA	28051089
GO:0005886	Component	Plasma membrane	IEA
GO:0005912	Component	Adherens junction	IBA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008013	Function	Beta-catenin binding	IDA	28051089
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0034332	Process	Adherens junction organization	IBA
GO:0035710	Process	CD4-positive, alpha-beta T cell activation	IDA	28051089
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045294	Function	Alpha-catenin binding	IDA	28051089
GO:0045296	Function	Cadherin binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0070097	Function	Delta-catenin binding	IDA	28051089
GO:0098609	Process	Cell-cell adhesion	IEA

Other IDs

• MIM: 617685
• HGNC: 15902
• e!Ensembl: ENSG00000124215

Protein

• UniProt ID: Q8IXH8
• Protein name: Cadherin-like protein 26 (Cadherin-like protein VR20)
• Protein function: Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Ligand for integrins alpha
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00028	Cadherin	170 → 266	Cadherin domain	Domain
  PF00028	Cadherin	280 → 388	Cadherin domain	Domain
  PF00028	Cadherin	401 → 490	Cadherin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by epithelial cells of gastrointestinal tissue. {ECO:0000269|PubMed:28051089}.
• Sequence:

  MAMRSGRHPSLLLLLVLLLWLLQVSIIDSVQQETDDLTKQTKEKIYQPLRRSKRRWVITT
  LELEEEDPGPFPKLIGELFNNMSYNMSLMYLISGPGVDEYPEIGLFSLEDHENGRIYVHR
  PVDREMTPSFTVYFDVVERSTGKIVDTSLIFNIRISDVNDHAPQFPEKEFNITVQENQSA
  GQPIFQMLAVDLDEENTPNSQVLYFLISQTPLLKESGFRVDRLSGEIRLSGCLDYETAPQ
  FTLLIRARDCGEPSLSSTTTVHVDVQEGNNHRPAFTQENYKVQIPEGRASQGVLRLLVQD
  RDSPFTSAWRAKFNILHGNEEGHFDISTDPETNEGILNVIKPLDYETRPAQSLIIVVENE
  ERLVFCERGKLQPPRKAAASATVSVQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNA
  MDPDSQIRYELVHDPANWVSVDKNSGVVITVEPIDRESPHVNNSFYVIIIHAVDDGFPPQ
  TATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDN
  TWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASG
  LTCVELADAEVGLHVGALFPVCAAFVALAVALLFLLRCYFVLEPKRHGCSVSNDEGHQTL
  VMYNAESKGTSAQTWSDVEGQRPALLICTAAAGPTQGVKDLEEVPPSAASQSAQARCALG
  SWGYGKPFEPRSVKNIHSTPAYPDATMHRQLLAPVEGRMAETLNQKLHVANVLEDDPGYL
  PHVYSEEGECGGAPSLSSLASLEQELQPDLLDSLGSKATPFEEIYSESGVPS

• Sequence length: 832

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
POST-OPERATIVE ACUTE KIDNEY INJURY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	35242247	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	37271320	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	38154664, 39343172	★☆☆☆☆ Found in Text Mining only
Ige Responsiveness Atopic	Associate	30584054	★☆☆☆☆ Found in Text Mining only