Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6041
Gene name Gene Name - the full gene name approved by the HGNC.	Ribonuclease L
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNASEL
Synonyms (NCBI Gene) Gene synonyms aliases	PRCA1, RNS4
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candida

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs486907	C>T	Risk-factor	Non coding transcript variant, coding sequence variant, missense variant
rs74315364	C>A	Conflicting-interpretations-of-pathogenicity, pathogenic, likely-pathogenic	Stop gained, non coding transcript variant, coding sequence variant
rs74315365	C>T	Pathogenic	Missense variant, non coding transcript variant, initiator codon variant
rs146336238	G>A	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, non coding transcript variant
rs147141911	C>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, non coding transcript variant

Show/Hide all(293)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000902	hsa-miR-15a-5p	Microarray	18362358
MIRT000901	hsa-miR-16-5p	Microarray	18362358
MIRT019056	hsa-miR-335-5p	Microarray	18185580
MIRT024876	hsa-miR-215-5p	Microarray	19074876
MIRT026865	hsa-miR-192-5p	Microarray	19074876
MIRT438434	hsa-miR-29a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	23113544
MIRT438434	hsa-miR-29a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR, Western blot	23113544
MIRT441869	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT441868	hsa-miR-4480	PAR-CLIP	22100165
MIRT441867	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441866	hsa-miR-8070	PAR-CLIP	22100165
MIRT441865	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT441869	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT441868	hsa-miR-4480	PAR-CLIP	22100165
MIRT441867	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT441866	hsa-miR-8070	PAR-CLIP	22100165
MIRT441865	hsa-miR-4776-3p	PAR-CLIP	22100165
MIRT1308787	hsa-miR-141	CLIP-seq
MIRT1308788	hsa-miR-200a	CLIP-seq
MIRT1308789	hsa-miR-3671	CLIP-seq
MIRT1308790	hsa-miR-4662a-3p	CLIP-seq
MIRT1308791	hsa-miR-4762-5p	CLIP-seq
MIRT1308792	hsa-miR-607	CLIP-seq
MIRT1308793	hsa-miR-802	CLIP-seq
MIRT2091612	hsa-miR-1252	CLIP-seq
MIRT2091613	hsa-miR-139-5p	CLIP-seq
MIRT2091614	hsa-miR-142-5p	CLIP-seq
MIRT2091615	hsa-miR-200b	CLIP-seq
MIRT2091616	hsa-miR-200c	CLIP-seq
MIRT2091617	hsa-miR-21	CLIP-seq
MIRT2091618	hsa-miR-28-3p	CLIP-seq
MIRT2091619	hsa-miR-320a	CLIP-seq
MIRT2091620	hsa-miR-320b	CLIP-seq
MIRT2091621	hsa-miR-320c	CLIP-seq
MIRT2091622	hsa-miR-320d	CLIP-seq
MIRT2091623	hsa-miR-338-3p	CLIP-seq
MIRT2091624	hsa-miR-34c-3p	CLIP-seq
MIRT2091625	hsa-miR-3688-3p	CLIP-seq
MIRT2091626	hsa-miR-4280	CLIP-seq
MIRT2091627	hsa-miR-429	CLIP-seq
MIRT2091628	hsa-miR-4422	CLIP-seq
MIRT2091629	hsa-miR-4429	CLIP-seq
MIRT2091630	hsa-miR-4530	CLIP-seq
MIRT2091631	hsa-miR-4639-3p	CLIP-seq
MIRT2091632	hsa-miR-548a-5p	CLIP-seq
MIRT2091633	hsa-miR-548ab	CLIP-seq
MIRT2091634	hsa-miR-548ak	CLIP-seq
MIRT2091635	hsa-miR-548b-5p	CLIP-seq
MIRT2091636	hsa-miR-548c-5p	CLIP-seq
MIRT2091637	hsa-miR-548d-5p	CLIP-seq
MIRT2091638	hsa-miR-548h	CLIP-seq
MIRT2091639	hsa-miR-548i	CLIP-seq
MIRT2091640	hsa-miR-548j	CLIP-seq
MIRT2091641	hsa-miR-548k	CLIP-seq
MIRT2091642	hsa-miR-548l	CLIP-seq
MIRT2091643	hsa-miR-548n	CLIP-seq
MIRT2091644	hsa-miR-548t	CLIP-seq
MIRT2091645	hsa-miR-548w	CLIP-seq
MIRT2091646	hsa-miR-548y	CLIP-seq
MIRT2091647	hsa-miR-559	CLIP-seq
MIRT2091648	hsa-miR-590-5p	CLIP-seq
MIRT2091649	hsa-miR-767-3p	CLIP-seq
MIRT2316208	hsa-miR-105	CLIP-seq
MIRT2091614	hsa-miR-142-5p	CLIP-seq
MIRT2091615	hsa-miR-200b	CLIP-seq
MIRT2091616	hsa-miR-200c	CLIP-seq
MIRT2091617	hsa-miR-21	CLIP-seq
MIRT2091618	hsa-miR-28-3p	CLIP-seq
MIRT2091619	hsa-miR-320a	CLIP-seq
MIRT2091620	hsa-miR-320b	CLIP-seq
MIRT2091621	hsa-miR-320c	CLIP-seq
MIRT2091622	hsa-miR-320d	CLIP-seq
MIRT2091625	hsa-miR-3688-3p	CLIP-seq
MIRT2316209	hsa-miR-375	CLIP-seq
MIRT2091626	hsa-miR-4280	CLIP-seq
MIRT2091627	hsa-miR-429	CLIP-seq
MIRT2316210	hsa-miR-4326	CLIP-seq
MIRT2091628	hsa-miR-4422	CLIP-seq
MIRT2091629	hsa-miR-4429	CLIP-seq
MIRT2316211	hsa-miR-4460	CLIP-seq
MIRT2316212	hsa-miR-4464	CLIP-seq
MIRT2316213	hsa-miR-4494	CLIP-seq
MIRT2316214	hsa-miR-4522	CLIP-seq
MIRT2316215	hsa-miR-4712-3p	CLIP-seq
MIRT2316216	hsa-miR-4727-3p	CLIP-seq
MIRT2316217	hsa-miR-4727-5p	CLIP-seq
MIRT2316218	hsa-miR-4748	CLIP-seq
MIRT2316219	hsa-miR-4769-3p	CLIP-seq
MIRT2316220	hsa-miR-4778-3p	CLIP-seq
MIRT2316221	hsa-miR-499a-5p	CLIP-seq
MIRT2091632	hsa-miR-548a-5p	CLIP-seq
MIRT2091633	hsa-miR-548ab	CLIP-seq
MIRT2091634	hsa-miR-548ak	CLIP-seq
MIRT2091635	hsa-miR-548b-5p	CLIP-seq
MIRT2091636	hsa-miR-548c-5p	CLIP-seq
MIRT2091637	hsa-miR-548d-5p	CLIP-seq
MIRT2091638	hsa-miR-548h	CLIP-seq
MIRT2091639	hsa-miR-548i	CLIP-seq
MIRT2091640	hsa-miR-548j	CLIP-seq
MIRT2091641	hsa-miR-548k	CLIP-seq
MIRT2091642	hsa-miR-548l	CLIP-seq
MIRT2091645	hsa-miR-548w	CLIP-seq
MIRT2091646	hsa-miR-548y	CLIP-seq
MIRT2316222	hsa-miR-555	CLIP-seq
MIRT2091647	hsa-miR-559	CLIP-seq
MIRT2091648	hsa-miR-590-5p	CLIP-seq
MIRT2316223	hsa-miR-657	CLIP-seq
MIRT2091649	hsa-miR-767-3p	CLIP-seq
MIRT2091618	hsa-miR-28-3p	CLIP-seq
MIRT2458297	hsa-miR-1914	CLIP-seq
MIRT2458298	hsa-miR-3151	CLIP-seq
MIRT2458299	hsa-miR-3192	CLIP-seq
MIRT2458300	hsa-miR-4283	CLIP-seq
MIRT2458301	hsa-miR-4300	CLIP-seq
MIRT2458302	hsa-miR-4447	CLIP-seq
MIRT2458303	hsa-miR-4472	CLIP-seq
MIRT2458304	hsa-miR-4489	CLIP-seq
MIRT2458305	hsa-miR-4656	CLIP-seq
MIRT2458306	hsa-miR-491-5p	CLIP-seq
MIRT2458307	hsa-miR-661	CLIP-seq
MIRT2458308	hsa-miR-920	CLIP-seq
MIRT2316208	hsa-miR-105	CLIP-seq
MIRT2612301	hsa-miR-1236	CLIP-seq
MIRT2091612	hsa-miR-1252	CLIP-seq
MIRT2612302	hsa-miR-1266	CLIP-seq
MIRT2612303	hsa-miR-1293	CLIP-seq
MIRT2612304	hsa-miR-130a	CLIP-seq
MIRT2612305	hsa-miR-130b	CLIP-seq
MIRT2612306	hsa-miR-1343	CLIP-seq
MIRT2612307	hsa-miR-146a	CLIP-seq
MIRT2612308	hsa-miR-146b-5p	CLIP-seq
MIRT2612309	hsa-miR-1470	CLIP-seq
MIRT2612310	hsa-miR-148a	CLIP-seq
MIRT2612311	hsa-miR-148b	CLIP-seq
MIRT2612312	hsa-miR-152	CLIP-seq
MIRT2612313	hsa-miR-198	CLIP-seq
MIRT2612314	hsa-miR-19a	CLIP-seq
MIRT2612315	hsa-miR-19b	CLIP-seq
MIRT2091615	hsa-miR-200b	CLIP-seq
MIRT2091616	hsa-miR-200c	CLIP-seq
MIRT2612316	hsa-miR-2052	CLIP-seq
MIRT2091617	hsa-miR-21	CLIP-seq
MIRT2612317	hsa-miR-2114	CLIP-seq
MIRT2612318	hsa-miR-2116	CLIP-seq
MIRT2091618	hsa-miR-28-3p	CLIP-seq
MIRT2612319	hsa-miR-301a	CLIP-seq
MIRT2612320	hsa-miR-301b	CLIP-seq
MIRT2612321	hsa-miR-3148	CLIP-seq
MIRT2458298	hsa-miR-3151	CLIP-seq
MIRT2612322	hsa-miR-3200-5p	CLIP-seq
MIRT2091619	hsa-miR-320a	CLIP-seq
MIRT2091620	hsa-miR-320b	CLIP-seq
MIRT2091621	hsa-miR-320c	CLIP-seq
MIRT2091622	hsa-miR-320d	CLIP-seq
MIRT2612323	hsa-miR-323-5p	CLIP-seq
MIRT2091623	hsa-miR-338-3p	CLIP-seq
MIRT2612324	hsa-miR-342-5p	CLIP-seq
MIRT2091624	hsa-miR-34c-3p	CLIP-seq
MIRT2612325	hsa-miR-361-3p	CLIP-seq
MIRT2612326	hsa-miR-3664-3p	CLIP-seq
MIRT2612327	hsa-miR-3666	CLIP-seq
MIRT2612328	hsa-miR-3682-3p	CLIP-seq
MIRT2091625	hsa-miR-3688-3p	CLIP-seq
MIRT2612329	hsa-miR-3690	CLIP-seq
MIRT2612330	hsa-miR-3907	CLIP-seq
MIRT2612331	hsa-miR-3909	CLIP-seq
MIRT2612332	hsa-miR-3921	CLIP-seq
MIRT2612333	hsa-miR-3974	CLIP-seq
MIRT2612334	hsa-miR-4254	CLIP-seq
MIRT2612335	hsa-miR-4276	CLIP-seq
MIRT2612336	hsa-miR-4277	CLIP-seq
MIRT2091627	hsa-miR-429	CLIP-seq
MIRT2612337	hsa-miR-4295	CLIP-seq
MIRT2612338	hsa-miR-4307	CLIP-seq
MIRT2612339	hsa-miR-4313	CLIP-seq
MIRT2316210	hsa-miR-4326	CLIP-seq
MIRT2091629	hsa-miR-4429	CLIP-seq
MIRT2458302	hsa-miR-4447	CLIP-seq
MIRT2612340	hsa-miR-4450	CLIP-seq
MIRT2316211	hsa-miR-4460	CLIP-seq
MIRT2458303	hsa-miR-4472	CLIP-seq
MIRT2612341	hsa-miR-4483	CLIP-seq
MIRT2316213	hsa-miR-4494	CLIP-seq
MIRT2612342	hsa-miR-4518	CLIP-seq
MIRT2612343	hsa-miR-451b	CLIP-seq
MIRT2316214	hsa-miR-4522	CLIP-seq
MIRT2612344	hsa-miR-4524	CLIP-seq
MIRT2091630	hsa-miR-4530	CLIP-seq
MIRT2612345	hsa-miR-454	CLIP-seq
MIRT2091631	hsa-miR-4639-3p	CLIP-seq
MIRT2612346	hsa-miR-4651	CLIP-seq
MIRT2612347	hsa-miR-4653-5p	CLIP-seq
MIRT2612348	hsa-miR-4664-5p	CLIP-seq
MIRT2612349	hsa-miR-4667-3p	CLIP-seq
MIRT2612350	hsa-miR-4682	CLIP-seq
MIRT2612351	hsa-miR-4694-3p	CLIP-seq
MIRT2612352	hsa-miR-4724-5p	CLIP-seq
MIRT2316216	hsa-miR-4727-3p	CLIP-seq
MIRT2316217	hsa-miR-4727-5p	CLIP-seq
MIRT2316219	hsa-miR-4769-3p	CLIP-seq
MIRT2316220	hsa-miR-4778-3p	CLIP-seq
MIRT2612353	hsa-miR-490-5p	CLIP-seq
MIRT2458306	hsa-miR-491-5p	CLIP-seq
MIRT2316221	hsa-miR-499a-5p	CLIP-seq
MIRT2612354	hsa-miR-522	CLIP-seq
MIRT2612355	hsa-miR-548aa	CLIP-seq
MIRT2612356	hsa-miR-548ae	CLIP-seq
MIRT2612357	hsa-miR-548aj	CLIP-seq
MIRT2612358	hsa-miR-548am	CLIP-seq
MIRT2612359	hsa-miR-548x	CLIP-seq
MIRT2316222	hsa-miR-555	CLIP-seq
MIRT2612360	hsa-miR-580	CLIP-seq
MIRT2612361	hsa-miR-589	CLIP-seq
MIRT2091648	hsa-miR-590-5p	CLIP-seq
MIRT2612362	hsa-miR-603	CLIP-seq
MIRT2612363	hsa-miR-606	CLIP-seq
MIRT2612364	hsa-miR-608	CLIP-seq
MIRT2612365	hsa-miR-627	CLIP-seq
MIRT2612366	hsa-miR-764	CLIP-seq
MIRT2612367	hsa-miR-924	CLIP-seq
MIRT2316208	hsa-miR-105	CLIP-seq
MIRT2612301	hsa-miR-1236	CLIP-seq
MIRT2091612	hsa-miR-1252	CLIP-seq
MIRT2612303	hsa-miR-1293	CLIP-seq
MIRT2612304	hsa-miR-130a	CLIP-seq
MIRT2612305	hsa-miR-130b	CLIP-seq
MIRT2612306	hsa-miR-1343	CLIP-seq
MIRT2612307	hsa-miR-146a	CLIP-seq
MIRT2612308	hsa-miR-146b-5p	CLIP-seq
MIRT2612309	hsa-miR-1470	CLIP-seq
MIRT2612310	hsa-miR-148a	CLIP-seq
MIRT2612311	hsa-miR-148b	CLIP-seq
MIRT2612312	hsa-miR-152	CLIP-seq
MIRT2689786	hsa-miR-1910	CLIP-seq
MIRT2612314	hsa-miR-19a	CLIP-seq
MIRT2612315	hsa-miR-19b	CLIP-seq
MIRT2091615	hsa-miR-200b	CLIP-seq
MIRT2091616	hsa-miR-200c	CLIP-seq
MIRT2612316	hsa-miR-2052	CLIP-seq
MIRT2612317	hsa-miR-2114	CLIP-seq
MIRT2091618	hsa-miR-28-3p	CLIP-seq
MIRT2689787	hsa-miR-2861	CLIP-seq
MIRT2612319	hsa-miR-301a	CLIP-seq
MIRT2612320	hsa-miR-301b	CLIP-seq
MIRT2612321	hsa-miR-3148	CLIP-seq
MIRT2458298	hsa-miR-3151	CLIP-seq
MIRT2612322	hsa-miR-3200-5p	CLIP-seq
MIRT2612323	hsa-miR-323-5p	CLIP-seq
MIRT2091623	hsa-miR-338-3p	CLIP-seq
MIRT2612324	hsa-miR-342-5p	CLIP-seq
MIRT2091624	hsa-miR-34c-3p	CLIP-seq
MIRT2612325	hsa-miR-361-3p	CLIP-seq
MIRT2612327	hsa-miR-3666	CLIP-seq
MIRT2091625	hsa-miR-3688-3p	CLIP-seq
MIRT2612329	hsa-miR-3690	CLIP-seq
MIRT2612331	hsa-miR-3909	CLIP-seq
MIRT2612333	hsa-miR-3974	CLIP-seq
MIRT2612334	hsa-miR-4254	CLIP-seq
MIRT2612335	hsa-miR-4276	CLIP-seq
MIRT2091627	hsa-miR-429	CLIP-seq
MIRT2612337	hsa-miR-4295	CLIP-seq
MIRT2612339	hsa-miR-4313	CLIP-seq
MIRT2091628	hsa-miR-4422	CLIP-seq
MIRT2458302	hsa-miR-4447	CLIP-seq
MIRT2458303	hsa-miR-4472	CLIP-seq
MIRT2612341	hsa-miR-4483	CLIP-seq
MIRT2316213	hsa-miR-4494	CLIP-seq
MIRT2612343	hsa-miR-451b	CLIP-seq
MIRT2316214	hsa-miR-4522	CLIP-seq
MIRT2612344	hsa-miR-4524	CLIP-seq
MIRT2091630	hsa-miR-4530	CLIP-seq
MIRT2612345	hsa-miR-454	CLIP-seq
MIRT2612346	hsa-miR-4651	CLIP-seq
MIRT2612348	hsa-miR-4664-5p	CLIP-seq
MIRT2612349	hsa-miR-4667-3p	CLIP-seq
MIRT2612350	hsa-miR-4682	CLIP-seq
MIRT2612352	hsa-miR-4724-5p	CLIP-seq
MIRT2316217	hsa-miR-4727-5p	CLIP-seq
MIRT2316219	hsa-miR-4769-3p	CLIP-seq
MIRT2316220	hsa-miR-4778-3p	CLIP-seq
MIRT2612353	hsa-miR-490-5p	CLIP-seq
MIRT2458306	hsa-miR-491-5p	CLIP-seq
MIRT2316221	hsa-miR-499a-5p	CLIP-seq
MIRT2612355	hsa-miR-548aa	CLIP-seq
MIRT2612356	hsa-miR-548ae	CLIP-seq
MIRT2612357	hsa-miR-548aj	CLIP-seq
MIRT2612358	hsa-miR-548am	CLIP-seq
MIRT2612359	hsa-miR-548x	CLIP-seq
MIRT2612360	hsa-miR-580	CLIP-seq
MIRT2612361	hsa-miR-589	CLIP-seq
MIRT2612362	hsa-miR-603	CLIP-seq
MIRT2612363	hsa-miR-606	CLIP-seq
MIRT2612364	hsa-miR-608	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
BRCA1	Activation	15940267

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IBA	21873635
GO:0003723	Function	RNA binding	IDA	7514601
GO:0004521	Function	Endoribonuclease activity	NAS	7514601
GO:0004540	Function	Ribonuclease activity	IBA	21873635
GO:0004672	Function	Protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7539425, 20875083
GO:0005524	Function	ATP binding	IEA
GO:0005575	Component	Cellular_component	ND
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0005829	Component	Cytosol	TAS
GO:0006364	Process	RRNA processing	IEA
GO:0006396	Process	RNA processing	IBA	21873635
GO:0006397	Process	MRNA processing	IEA
GO:0006468	Process	Protein phosphorylation	NAS	7514601
GO:0016363	Component	Nuclear matrix	IEA
GO:0019843	Function	RRNA binding	IEA
GO:0043021	Function	Ribonucleoprotein complex binding	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IBA	21873635
GO:0045071	Process	Negative regulation of viral genome replication	IDA	19923450
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19245366
GO:0046326	Process	Positive regulation of glucose import	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IBA	21873635
GO:0051607	Process	Defense response to virus	IDA	19923450
GO:0051607	Process	Defense response to virus	TAS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0060338	Process	Regulation of type I interferon-mediated signaling pathway	TAS
GO:0090502	Process	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA

MIM	HGNC	e!Ensembl
180435	10050	ENSG00000135828

Protein

UniProt ID

Q05823

Protein name

2-5A-dependent ribonuclease (2-5A-dependent RNase) (EC 3.1.26.-) (Ribonuclease 4) (Ribonuclease L) (RNase L)

Protein function

Endoribonuclease that functions in the interferon (IFN) antiviral response. In INF treated and virus infected cells, RNASEL probably mediates its antiviral effects through a combination of direct cleavage of single-stranded viral RNAs, inhibitio

PDB

1WDY , 4G8K , 4G8L , 4OAU , 4OAV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00023	Ank	58 → 89	Ankyrin repeat	Repeat
PF00023	Ank	167 → 200	Ankyrin repeat	Repeat
PF00069	Pkinase	368 → 524	Protein kinase domain	Domain
PF06479	Ribonuc_2-5A	592 → 720	Ribonuclease 2-5A	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen and thymus followed by prostate, testis, uterus, small intestine, colon and peripheral blood leukocytes.

Sequence

MESRDHNNPQEGPTSSSGRRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGW
TPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNE
CDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEKGH
VEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGK
TPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTD
CGDLVMTARRNYDHSLVKVLLSHGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGK
LKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTF
YGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCG
YTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFE
DLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVG
NESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVG
DLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTH
SPNKPQCDGAGGASGLASPGC

Sequence length

741

Interactions

View interactions

	KEGG		Reactome
	NOD-like receptor signaling pathway Hepatitis C Influenza A Herpes simplex virus 1 infection		OAS antiviral response Interferon alpha/beta signaling

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	23412934
Prostate cancer	Malignant neoplasm of prostate, Prostate cancer, familial, Familial prostate cancer	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	27318894, 16114055, 17020975, 23141781, 28031937
Prostate cancer, hereditary	PROSTATE CANCER, HEREDITARY, 1	rs387906327, rs193929331, rs74315365, rs397516896, rs794729219, rs121913349, rs587782641, rs1114167673, rs1597371666, rs2073394466

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	17263642
Acute Retroviral Syndrome	Associate	19567509
Adenocarcinoma of Lung	Associate	28362255
Aicardi Goutieres syndrome	Associate	32958664
Breast Neoplasms	Associate	18575592, 25070080, 29422015
Calcinosis Cutis	Associate	12915880
Calculi	Associate	18676870
Carcinoma Hepatocellular	Associate	28704535
Carcinoma Squamous Cell	Associate	24699816
Cerebral Infarction	Associate	39290696
Colorectal Neoplasms	Associate	39844333
Cytokine Release Syndrome	Associate	36538032
Deltaretrovirus Infections	Associate	22356654
Drug Related Side Effects and Adverse Reactions	Associate	30814222
Enteritis	Associate	24733098
Esophageal Neoplasms	Associate	24551278
Gastrointestinal Diseases	Associate	24733098
Genetic Diseases Inborn	Associate	7679499
Glucosephosphate Dehydrogenase Deficiency	Inhibit	28053103
Hepatitis B Chronic	Associate	22356654
Hepatitis C	Associate	23196181
Hepatitis C Chronic	Associate	28704535
HIV Infections	Stimulate	17263642
HIV Infections	Associate	9847332
Immune System Diseases	Associate	32888207
Infections	Associate	16609730, 21360564, 22356654
Inflammation	Associate	23057767, 23382116, 26771888
Kidney Failure Chronic	Associate	20576793
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	9834240
Lung Neoplasms	Associate	31501431
Mouth Neoplasms	Associate	25337191
Multiple Myeloma	Associate	34411225
Neoplasm Invasiveness	Associate	29422015
Neoplasms	Associate	11941539, 15330212, 18289577, 18575592, 20875083, 23057767, 24224612, 26251261, 26263979, 28257035, 31501431, 32233832, 39844333, 7679499, 9490801
Neoplasms	Inhibit	17237228
Obesity	Associate	28903065
Papillomavirus Infections	Associate	18575592
pediatric multisystem inflammatory disease COVID 19 related	Associate	36538032
Personality Disorders	Associate	26251261
Picornaviridae Infections	Associate	9847332
Prostate cancer familial	Associate	11941539, 12022038, 12145743, 12915880, 18575592, 18767027, 20564318, 21638280, 28257035, 35655265
Prostatic Neoplasms	Associate	11941539, 12022038, 12145743, 12915880, 15330212, 16203993, 16609730, 17145707, 18289577, 18575592, 18767027, 19959199, 20086112, 20564318, 20576103 View all (12 more)
Prostatitis	Associate	16609730, 18289577, 21360564
Skin Neoplasms	Associate	24699816
Squamous Cell Carcinoma of Head and Neck	Associate	18575592
Stroke	Associate	39290696
Unilateral Breast Neoplasms	Associate	18575592
Uterine Cervical Neoplasms	Associate	18575592
Virus Diseases	Associate	15711931, 20576103, 20576793, 20875083, 21360564, 26263979, 31031002, 32295917, 32958664, 7679499
Zika Virus Infection	Associate	31142667

RNASEL (ribonuclease L)