BCL6 (BCL6 transcription repressor)

Gene

• Entrez ID: 604
• Gene name: BCL6 transcription repressor
• Gene symbol: BCL6
• Synonyms (NCBI Gene): BCL5, BCL6A, LAZ3, ZBTB27, ZNF51
• Chromosome: 3
• Chromosome location: 3q27.3
• Summary: The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal POZ domain. This protein acts as a sequence-specific repressor of transcription, and has been shown to modulate the transcription of STAT-dependent IL-4 resp

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000640	hsa-miR-9-5p	Luciferase reporter assay	19956200
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay	17581274
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	16766263
MIRT004463	hsa-miR-127-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	16766263
MIRT005929	hsa-miR-339-5p	qRT-PCR	20932331
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, qRT-PCR, Western blot	22387553
MIRT006927	hsa-miR-155-5p	Luciferase reporter assay	23041630
MIRT006927	hsa-miR-155-5p	Luciferase reporter assay	23041630
MIRT017492	hsa-miR-335-5p	Microarray	18185580
MIRT022507	hsa-miR-124-3p	Microarray	18668037
MIRT035524	hsa-miR-21-5p	Luciferase reporter assay	23416424
MIRT035524	hsa-miR-21-5p	Luciferase reporter assay	23416424
MIRT054375	hsa-miR-205-5p	Luciferase reporter assay, Western blot	22870299
MIRT054375	hsa-miR-205-5p	Luciferase reporter assay, Western blot	22870299
MIRT005929	hsa-miR-339-5p	Immunohistochemistry, Luciferase reporter assay, Western blot	24917186
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	26845350
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	26845350
MIRT731339	hsa-miR-187-3p	Luciferase reporter assay	27073562
MIRT732380	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	27186677
MIRT732380	hsa-miR-544a	Luciferase reporter assay, qRT-PCR, Western blot	27186677
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT006927	hsa-miR-155-5p	qRT-PCR, Western blot	26986233
MIRT734457	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, In situ hybridization	31903129
MIRT735771	hsa-miR-139-3p	Luciferase reporter assay, qRT-PCR	32277518
MIRT735771	hsa-miR-139-3p	Luciferase reporter assay, qRT-PCR	32277518
MIRT735800	hsa-miR-1247-5p	Western blotting, qRT-PCR	33425899
MIRT736975	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	32206063
MIRT755806	miR?144?3p	Luciferase reporter assay, Western blotting, qRT-PCR	34504602
MIRT006324	hsa-miR-30b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35100079
MIRT819383	hsa-miR-101	CLIP-seq
MIRT819384	hsa-miR-106a	CLIP-seq
MIRT819385	hsa-miR-106b	CLIP-seq
MIRT819386	hsa-miR-10a	CLIP-seq
MIRT819387	hsa-miR-10b	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819389	hsa-miR-1203	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819391	hsa-miR-1225-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT819393	hsa-miR-1244	CLIP-seq
MIRT819394	hsa-miR-1255a	CLIP-seq
MIRT819395	hsa-miR-1255b	CLIP-seq
MIRT819396	hsa-miR-129-5p	CLIP-seq
MIRT819397	hsa-miR-144	CLIP-seq
MIRT819398	hsa-miR-17	CLIP-seq
MIRT819399	hsa-miR-20a	CLIP-seq
MIRT819400	hsa-miR-20b	CLIP-seq
MIRT819401	hsa-miR-3121-5p	CLIP-seq
MIRT819402	hsa-miR-3140-3p	CLIP-seq
MIRT819403	hsa-miR-329	CLIP-seq
MIRT819404	hsa-miR-3609	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT819406	hsa-miR-362-3p	CLIP-seq
MIRT819407	hsa-miR-362-5p	CLIP-seq
MIRT819408	hsa-miR-3681	CLIP-seq
MIRT819409	hsa-miR-3691-5p	CLIP-seq
MIRT819410	hsa-miR-374c	CLIP-seq
MIRT819411	hsa-miR-3941	CLIP-seq
MIRT819412	hsa-miR-4325	CLIP-seq
MIRT819413	hsa-miR-4421	CLIP-seq
MIRT819414	hsa-miR-4731-3p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819416	hsa-miR-4796-3p	CLIP-seq
MIRT819417	hsa-miR-4801	CLIP-seq
MIRT819418	hsa-miR-500b	CLIP-seq
MIRT819419	hsa-miR-501-5p	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT819422	hsa-miR-519d	CLIP-seq
MIRT819423	hsa-miR-548ah	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT819426	hsa-miR-582-5p	CLIP-seq
MIRT819427	hsa-miR-603	CLIP-seq
MIRT819428	hsa-miR-628-5p	CLIP-seq
MIRT819429	hsa-miR-655	CLIP-seq
MIRT819430	hsa-miR-93	CLIP-seq
MIRT1942121	hsa-miR-1275	CLIP-seq
MIRT1942122	hsa-miR-153	CLIP-seq
MIRT1942123	hsa-miR-187	CLIP-seq
MIRT1942124	hsa-miR-3158-5p	CLIP-seq
MIRT1942125	hsa-miR-331-3p	CLIP-seq
MIRT1942126	hsa-miR-4288	CLIP-seq
MIRT1942127	hsa-miR-4300	CLIP-seq
MIRT1942128	hsa-miR-4447	CLIP-seq
MIRT1942129	hsa-miR-4464	CLIP-seq
MIRT1942130	hsa-miR-4472	CLIP-seq
MIRT1942131	hsa-miR-448	CLIP-seq
MIRT1942132	hsa-miR-450b-5p	CLIP-seq
MIRT1942133	hsa-miR-4525	CLIP-seq
MIRT1942134	hsa-miR-4665-5p	CLIP-seq
MIRT1942135	hsa-miR-4716-3p	CLIP-seq
MIRT1942136	hsa-miR-4723-5p	CLIP-seq
MIRT1942137	hsa-miR-4728-5p	CLIP-seq
MIRT1942138	hsa-miR-4748	CLIP-seq
MIRT1942139	hsa-miR-4763-5p	CLIP-seq
MIRT1942140	hsa-miR-489	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT1942141	hsa-miR-514	CLIP-seq
MIRT1942142	hsa-miR-514b-3p	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT1942143	hsa-miR-558	CLIP-seq
MIRT1942144	hsa-miR-625	CLIP-seq
MIRT1942145	hsa-miR-632	CLIP-seq
MIRT1942146	hsa-miR-920	CLIP-seq
MIRT1942147	hsa-miR-939	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT1942122	hsa-miR-153	CLIP-seq
MIRT2180997	hsa-miR-300	CLIP-seq
MIRT2180998	hsa-miR-3613-3p	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT2180999	hsa-miR-381	CLIP-seq
MIRT1942126	hsa-miR-4288	CLIP-seq
MIRT1942131	hsa-miR-448	CLIP-seq
MIRT1942132	hsa-miR-450b-5p	CLIP-seq
MIRT2181000	hsa-miR-4666-3p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819421	hsa-miR-507	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT819425	hsa-miR-557	CLIP-seq
MIRT1942145	hsa-miR-632	CLIP-seq
MIRT819388	hsa-miR-1197	CLIP-seq
MIRT819390	hsa-miR-1224-5p	CLIP-seq
MIRT819392	hsa-miR-124	CLIP-seq
MIRT819405	hsa-miR-3613-5p	CLIP-seq
MIRT819415	hsa-miR-4751	CLIP-seq
MIRT819420	hsa-miR-506	CLIP-seq
MIRT819424	hsa-miR-548an	CLIP-seq
MIRT2484362	hsa-miR-1253	CLIP-seq
MIRT2484363	hsa-miR-183	CLIP-seq
MIRT2484364	hsa-miR-3185	CLIP-seq
MIRT2484365	hsa-miR-34a	CLIP-seq
MIRT2484366	hsa-miR-34c-5p	CLIP-seq
MIRT819411	hsa-miR-3941	CLIP-seq
MIRT2484367	hsa-miR-3942-5p	CLIP-seq
MIRT2484368	hsa-miR-409-3p	CLIP-seq
MIRT2484369	hsa-miR-4307	CLIP-seq
MIRT2484370	hsa-miR-4434	CLIP-seq
MIRT2484371	hsa-miR-449a	CLIP-seq
MIRT2484372	hsa-miR-449b	CLIP-seq
MIRT2484373	hsa-miR-4516	CLIP-seq
MIRT2484374	hsa-miR-4517	CLIP-seq
MIRT2484375	hsa-miR-4643	CLIP-seq
MIRT2484376	hsa-miR-466	CLIP-seq
MIRT2484377	hsa-miR-4672	CLIP-seq
MIRT2484378	hsa-miR-4703-5p	CLIP-seq
MIRT2484379	hsa-miR-4789-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Repression	15509806
BCL6	Repression	12407182
CTCF	Repression	20733034
FOSL2	Activation	22493372
FOXO3	Activation	15509806
FOXO4	Activation	11777915
IRF4	Repression	17785200
JUND	Activation	22493372
JUND	Repression	18071306
MEF2B	Unknown	23974956
SPI1	Repression	19564417
STAT3	Activation	20228272;23716595
STAT5	Repression	23716595
STAT5A	Repression	16819511
STAT5B	Repression	16819511
ZEB1	Repression	20175752

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11929873
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15577913, 16704730
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001161	Function	Intronic transcription regulatory region sequence-specific DNA binding	IEA
GO:0001222	Function	Transcription corepressor binding	IPI	10898795
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	16704730
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001817	Process	Regulation of cytokine production	IBA
GO:0001953	Process	Negative regulation of cell-matrix adhesion	IEA
GO:0002317	Process	Plasma cell differentiation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002467	Process	Germinal center formation	IEA
GO:0002634	Process	Regulation of germinal center formation	NAS	7795255
GO:0002682	Process	Regulation of immune system process	IBA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0002903	Process	Negative regulation of B cell apoptotic process	NAS	15577913
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	12097386
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	15577913
GO:0005515	Function	Protein binding	IPI	12590135, 16147992, 16819511, 21390126, 22113614, 25416956, 27107012, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	7795255, 10898795, 11929873
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IDA	10490843
GO:0005730	Component	Nucleolus	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006974	Process	DNA damage response	IDA	15577913
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0021859	Process	Pyramidal neuron differentiation	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IDA	10490843
GO:0030890	Process	Positive regulation of B cell proliferation	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0031507	Process	Heterochromatin formation	IEA
GO:0032764	Process	Negative regulation of mast cell cytokine production	IEA
GO:0032943	Process	Mononuclear cell proliferation	IEA
GO:0032945	Process	Negative regulation of mononuclear cell proliferation	IEA
GO:0035024	Process	Negative regulation of Rho protein signal transduction	IEA
GO:0042092	Process	Type 2 immune response	IBA
GO:0042092	Process	Type 2 immune response	IEA
GO:0042100	Process	B cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042129	Process	Regulation of T cell proliferation	IEA
GO:0042382	Component	Paraspeckles	IDA	16704730
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	10490843
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043380	Process	Regulation of memory T cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	15577913
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IMP	20935202, 22387553
GO:0045595	Process	Regulation of cell differentiation	IBA
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045629	Process	Negative regulation of T-helper 2 cell differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	15577913
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	9135990
GO:0046872	Function	Metal ion binding	IEA
GO:0048289	Process	Isotype switching to IgE isotypes	IEA
GO:0048294	Process	Negative regulation of isotype switching to IgE isotypes	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0048870	Process	Cell motility	IEA
GO:0050727	Process	Regulation of inflammatory response	IBA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050776	Process	Regulation of immune response	NAS	16455075
GO:0051251	Process	Positive regulation of lymphocyte activation	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16704730
GO:1900099	Process	Negative regulation of plasma cell differentiation	IEA
GO:1903037	Process	Regulation of leukocyte cell-cell adhesion	IEA
GO:1903464	Process	Negative regulation of mitotic cell cycle DNA replication	NAS	10490843
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000147	Process	Positive regulation of cell motility	IEA
GO:2000773	Process	Negative regulation of cellular senescence	IEA

Other IDs

• MIM: 109565
• HGNC: 1001
• e!Ensembl: ENSG00000113916

Protein

• UniProt ID: P41182
• Protein name: B-cell lymphoma 6 protein (BCL-6) (B-cell lymphoma 5 protein) (BCL-5) (Protein LAZ-3) (Zinc finger and BTB domain-containing protein 27) (Zinc finger protein 51)
• Protein function: Transcriptional repressor mainly required for germinal center (GC) formation and antibody affinity maturation which has different mechanisms of action specific to the lineage and biological functions. Forms complexes with different corepressors
• PDB: 1R28, 1R29, 1R2B, 2EN2, 2EOS, 2LCE, 2YRM, 3BIM, 3E4U, 3LBZ, 4CP3, 4U2M, 5H7G, 5H7H, 5MW2, 5MW6, 5MWD, 5N1X, 5N1Z, 5N20, 5N21, 5X4M, 5X4N, 5X4O, 5X4P, 5X4Q, 5X9O, 5X9P, 6C3L, 6C3N, 6CQ1, 6EW6, 6EW7, 6EW8, 6TBT, 6TCJ, 6TOF, 6TOG, 6TOH, 6TOI, 6TOJ, 6TOK, 6TOL, 6TOM, 6TON, 6TOO, 6XMX, 6XWF, 6XXS, 6XYX, 6XZZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00651	BTB	22 → 129	BTB/POZ domain	Domain
  PF00096	zf-C2H2	546 → 568	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	574 → 596	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	602 → 624	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	630 → 652	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in germinal center T- and B-cells and in primary immature dendritic cells. {ECO:0000269|PubMed:10981963, ECO:0000269|PubMed:12402037, ECO:0000269|PubMed:15454082, ECO:0000269|PubMed:16142238, ECO:0000269|PubMed:16455075, ECO:
• Sequence:

  MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
  FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMATAMYLQMEHVVDT
  CRKFIKASEAEMVSAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRSAPGCESRAF
  APSLYSGLSTPPASYSMYSHLPVSSLLFSDEEFRDVRMPVANPFPKERALPCDSARPVPG
  EYSRPTLEVSPNVCHSNIYSPKETIPEEARSDMHYSVAEGLKPAAPSARNAPYFPCDKAS
  KEEERPSSEDEIALHFEPPNAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQASG
  SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
  ENLDLQSPTKLSASGEDSTIPQASRLNNIVNRSMTGSPRSSSESHSPLYMHPPKCTSCGS
  QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
  HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
  PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
  EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC

• Sequence length: 706

Pathways

KEGG:

FoxO signaling pathway
Transcriptional misregulation in cancer
Chemical carcinogenesis - receptor activation

Reactome:

Interleukin-4 and Interleukin-13 signaling
TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain
FOXO-mediated transcription of cell death genes

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	11157493
Abortion Spontaneous	Associate	30610661
Achalasia Addisonianism Alacrimia syndrome	Associate	26892631, 26931436, 29785017, 29903764, 30210134, 31171907, 31288832, 31315646, 32311849, 33168821, 33768318, 34698437, 36823603
Acquired Immunodeficiency Syndrome	Associate	11157493, 8025268, 9006332, 9160681, 9446632
Adenocarcinoma	Associate	20080664, 22491060
AIDS Associated Nephropathy	Associate	10090942
Alzheimer Disease	Associate	36334414
Amyotrophic Lateral Sclerosis	Associate	38191942
Anal Gland Neoplasms	Associate	34321419
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	23799890
Arthritis Juvenile	Associate	29848367
Arthritis Rheumatoid	Stimulate	22649468
Arthritis Rheumatoid	Associate	39586747
Autistic Disorder	Associate	18378158
Basal cell carcinoma infundibulocystic	Associate	28943543
Bisphosphonate Associated Osteonecrosis of the Jaw	Associate	30832685
Bone Marrow Diseases	Associate	8208268
Bone Resorption	Inhibit	30832685
Brain Diseases	Associate	18378158
Brain Neoplasms	Associate	32383815, 34887247
Breast Neoplasms	Associate	17963508, 23716595, 24282530, 24662818, 25477702, 26957268, 27029530, 28973975, 31227749, 33932086
Burkitt Lymphoma	Associate	10627476, 11157493, 12477975, 12907442, 20348878, 26763367, 34788985, 9160681, 9359519, 9402172
Burkitt Lymphoma	Inhibit	20080768
Burkitt Lymphoma	Stimulate	22358360
Calcinosis	Associate	34887247
Carcinogenesis	Associate	24220798, 31754389, 33393503
Carcinoma	Associate	30051528
Carcinoma Adenoid Cystic	Associate	17594153, 34321419
Carcinoma Non Small Cell Lung	Associate	22491060, 28377453, 33393503
Carcinoma Ovarian Epithelial	Associate	28671040
Carcinoma Squamous Cell	Associate	22491060, 36357817
Carcinoma Transitional Cell	Associate	17542409
Cardiomyopathies	Associate	32631246, 39294340
Cardiomyopathy Dilated	Associate	34669781
Central Nervous System Neoplasms	Associate	34887247
Chordoma	Associate	23533570
Chromosome 3 monosomy 3q27	Associate	8167331
Chromosome Aberrations	Stimulate	19633642
Colorectal Neoplasms	Associate	24220798, 32206063
Common Variable Immunodeficiency	Associate	10923927
Coronary Artery Disease	Associate	35151267
COVID 19	Associate	36334414, 36758547, 37486005
Crohn Disease	Associate	36746519
Cytokine Release Syndrome	Associate	15755285
Dermatomyositis	Associate	27803134
Diabetes Gestational	Associate	40122115
Diabetes Mellitus Type 2	Associate	32705173
Disease	Associate	11972514, 27803134, 29848367, 9787151
Down Syndrome	Associate	30515165
Drug Related Side Effects and Adverse Reactions	Associate	27742770
Endometriosis	Associate	27222232, 30610661, 34698105, 37085097
Eosinophilia	Associate	12477975
Epstein Barr Virus Infections	Associate	19193789, 19664325, 9006332
Epstein Barr Virus Infections	Inhibit	22711707
Esophageal Neoplasms	Associate	25923331
Fetal Growth Retardation	Associate	21810232
Fused Teeth	Associate	23341189, 23600716, 24625454, 26573234, 26931436, 29903764, 30348671
Gallbladder Neoplasms	Associate	24114011
Genetic Diseases Inborn	Associate	31109360, 31315646
Glioblastoma	Associate	25038272, 30420967
Glioma	Inhibit	25038272
Glioma	Associate	30420967
Glucosephosphate Dehydrogenase Deficiency	Associate	32722781
Glycogen Storage Disease Type IV	Associate	32843454
Granulomatosis with Polyangiitis	Associate	23799890, 35039330
Hemorrhage	Associate	12507894, 34887247
Hepatitis B	Associate	23107779
Hereditary Breast and Ovarian Cancer Syndrome	Associate	31734687
Hereditary leiomyomatosis and renal cell cancer	Associate	11290603
HIV Infections	Stimulate	25589617
HIV Infections	Associate	28065665, 30355686
Hodgkin Disease	Associate	11238128, 11290603, 12393409, 16049307, 19465900, 21424034, 24326827, 24678684, 9310496, 9746758
Huntington Disease	Associate	10090942, 11290603
Hyperplasia	Associate	9746767
Hypotension	Associate	30832685
IgA Vasculitis	Stimulate	26491701
Immunoproliferative Small Intestinal Disease	Associate	16773719
Infections	Associate	30355686
Inferior Wall Myocardial Infarction	Associate	29903764
Infertility	Associate	27222232, 29126613
Inflammation	Associate	12165517, 12477975, 23954399, 29029245, 36430854
Intestinal Diseases	Associate	16773719
Intraocular Lymphoma	Associate	16799010
Ischemia	Associate	30135684
Job Syndrome	Inhibit	22118528
Leukemia	Associate	19535347, 23107779, 28030830
Leukemia B Cell	Associate	10627476, 10828040, 17353367, 37140301, 9751748
Leukemia Biphenotypic Acute	Associate	30178847, 34049715
Leukemia Hairy Cell	Associate	10627476
Leukemia Lymphocytic Chronic B Cell	Associate	10627476, 10828040, 35149845
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	28410239
Leukemia Myeloid Acute	Associate	31085557, 37634473
Lung Diseases	Associate	34321419
Lung Diseases Interstitial	Associate	15153535
Lung Neoplasms	Inhibit	32234966
Lupus Erythematosus Systemic	Associate	31431691, 32245990
Lymphoma	Associate	10090923, 10666217, 10887128, 10898795, 11380473, 11943722, 12406872, 12515714, 12738680, 14655758, 16400323, 16494623, 16507780, 16728698, 16778825, 17545502, 17963508, 17999414, 18212045, 18451163, 18645192, 19525926, 19535347, 20032416, 20533006, 20733034, 20966935, 22041376, 22918164, 23341189, 23600716, 23795761, 24179151, 24362533, 24595451, 24625454, 24943107, 25038272, 25612555, 25640395, 25817328, 25991819, 26565895, 26702065, 27419806, 27764808, 28061782, 28771100, 28776574, 28930682, 29785017, 30181564, 30235749, 30348671, 30918199, 31171907, 31365872, 31419226, 31556696, 31712669, 31805190, 31997133, 32311849, 32362635, 33530253, 33551436, 33591648, 33786907, 34381423, 34608246, 34707037, 35895386, 39905397, 40651974, 8167331, 8547655, 9395180, 9401082, 9504630, 9617870, 9680371, 9746767
Lymphoma AIDS Related	Associate	11157493, 22358360, 39324141, 9446632
Lymphoma B Cell	Associate	10233393, 10627476, 11290603, 11943722, 12165517, 12173331, 12507907, 12580956, 12775568, 12860928, 14690607, 15098010, 15191563, 15577913, 15905193, 16778825, 18212045, 19298719, 19465899, 19880780, 20733034, 20966935, 23341189, 23476051, 23795761, 23852366, 24030746, 24761809, 24943107, 26229090, 26573234, 27764808, 27907212, 28984304, 29475959, 29785017, 29903764, 30181564, 30210134, 30348671, 30420967, 30523716, 31160360, 31254446, 31527075, 31712669, 31849147, 31872861, 31914056, 32311849, 32713346, 32722781, 32780847, 32843454, 33065767, 33120427, 33168821, 33306213, 33551436, 33768318, 34049715, 34500469, 34608246, 34788985, 35045798, 36109172, 36575004, 36853790, 39313500, 7961119, 8063612, 8167331, 8557040, 8618933, 8704258, 9359519, 9504630, 9649500, 9746758, 9751748
Lymphoma B Cell	Stimulate	20533006
Lymphoma B Cell Marginal Zone	Associate	11756145, 15153535, 15609396, 16772602, 18166802, 22110251, 26763367, 36853790, 9332330, 9395180
Lymphoma Follicular	Associate	10627476, 10666217, 10702417, 11290603, 12529293, 12738680, 15098010, 15277222, 15723651, 16728698, 17138820, 17296585, 17387393, 18264083, 18500267, 18925696, 19465899, 19549844, 20032416, 21988858, 25400800, 27513891, 28038709, 28324774, 28765546, 30348636, 31776129, 33211828, 33768318, 34601504, 34788985, 36575003, 37561599, 7795255, 8618933, 9427715
Lymphoma Large B Cell Diffuse	Associate	10627476, 10666217, 10702417, 10753856, 10887128, 11023530, 11123421, 11157493, 11290603, 11493437, 11742039, 11972514, 12173331, 12393466, 12406872, 12477975, 12515714, 12562237, 12907442, 14504078, 14556665, 14655758, 15115829, 15162151, 15277222, 15609396, 15755285, 15920553, 16147992, 16449523, 16728698, 16772602, 17038524, 17149956, 17360630, 17542409, 17545502, 17625604, 17785200, 17951530, 18165800, 18346918, 18378569, 18451163, 18925695, 18925696, 19307668, 19525926, 19549844, 19706817, 19797725, 19855081, 19935644, 20160358, 20441508, 20557674, 21655667, 22213394, 22358360, 22437443, 22726454, 22994707, 23335369, 23716595, 23740154, 23927977, 24122791, 24133582, 24595451, 24843885, 24887414, 25090026, 25589617, 25640395, 25769544, 26158410, 26214636, 26414904, 26573234, 26787899, 26857366, 26869285, 27027803, 27180090, 27268204, 27419806, 27469333, 27815824, 27825111, 28930682, 29088292, 29101361, 29475959, 29567771, 31109360, 31123031, 31171907, 31288832, 31315646, 31399522, 31527075, 31712669, 32281588, 32722781, 32736575, 32780847, 33168821, 33530253, 33768318, 34289655, 34654055, 34707034, 34788985, 35715938, 35794478, 36109172, 36329085, 36575004, 36823603, 36997030, 37032379, 37071673, 37495688, 38196006, 7795255, 8025268, 8142643, 8208268, 8557040, 8618933, 9160681, 9184180, 9332331, 9359519, 9401082, 9427715, 9541684, 9787151
Lymphoma Large Cell Anaplastic	Associate	11742039, 9160681, 9310496
Lymphoma Large Cell Anaplastic	Stimulate	17077326
Lymphoma Large Cell Immunoblastic	Associate	8025268
Lymphoma Mantle Cell	Associate	19826251, 32961552
Lymphoma Non Hodgkin	Associate	10666217, 10898795, 10923927, 11046151, 11290603, 11865059, 12107101, 12738680, 21241187, 23795960, 27764808, 8025268, 8063612, 8142643, 8167331, 9006332, 9160681, 9184180, 9332331, 9446632, 9746767
Lymphoma Primary Effusion	Associate	18166773, 9446632
Lymphoma T Cell	Associate	11133771, 28943543, 31556696
Lymphoma T Cell Peripheral	Associate	11742039, 9310496
Lymphoproliferative Disorders	Associate	12907442, 15153535, 18776761, 9746767
MASS syndrome	Associate	32843454
Mediastinitis	Associate	17625604
Melanoma	Associate	14695333
Melanoma	Stimulate	32002306
Meningioma	Inhibit	25038272
Microphthalmia syndromic 2	Associate	22983184
Multiple Myeloma	Associate	20228272, 26763361, 28420429, 28544233, 29654271, 37406588, 9746767
Multiple Sclerosis	Associate	35887298
Mycosis Fungoides	Associate	22918164
Myocardial Infarction	Associate	38228864
Nasopharyngeal Carcinoma	Associate	36412101
Necrosis	Associate	34887247
Neoplasms	Associate	10627476, 10666217, 16150948, 16773719, 17255358, 17360630, 17999414, 18451163, 18776761, 19144381, 19295409, 19855081, 20220064, 21596365, 22389885, 22395507, 23269799, 23335369, 23637631, 23927977, 24220798, 24282530, 25090026, 25170874, 25194535, 25817328, 26355571, 26491211, 26869285, 27237631, 27419806, 27764808, 28296741, 28671040, 29415979, 29505425, 30420967, 31556696, 31882486, 31914056, 32002306, 32412910, 32713346, 33393503, 33844535, 33932086, 35087134, 35503721, 35715938, 36542153, 39313500, 40076915, 40651974, 8557040, 9746758, 9751748
Neoplasms	Inhibit	15577913, 28377453, 31754389, 36412101
Neoplasms Neuroepithelial	Associate	32383815
Niemann Pick Disease Type C	Inhibit	36412101
Oncogene Addiction	Inhibit	19307668
Osteoarthritis	Associate	36781858
Otitis Media with Effusion	Associate	17594153
Ovarian Neoplasms	Associate	26553360, 27240592, 28671040, 32412910, 34126157, 40076915
Pancreatic Neoplasms	Associate	40294979
Parkinson Disease	Associate	36593912
Paroxysmal ventricular fibrillation	Associate	29126613
Pelvic Inflammatory Disease	Associate	36196757
Periodontitis	Associate	40294979
Peripheral Nervous System Diseases	Associate	30111286
Persistent Polyclonal B Cell Lymphocytosis	Associate	37140301
Philadelphia Chromosome	Associate	28410239, 34049715
Plasmablastic Lymphoma	Associate	12437635, 15578069
Pneumonia	Stimulate	32778874
Polyps	Associate	27468819
Pre Eclampsia	Stimulate	21810232
Pre Eclampsia	Associate	27029530, 33182312, 40122115
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	23107779, 30178847, 31776129
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	11742039, 17485517, 18618503, 23494176, 25759025, 28030830, 28410239, 30103201
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	30185437, 34049715, 37522711
Preeclamptic toxemia	Associate	27029530, 33182312
Premature Birth	Associate	30135684
Progesterone Resistance	Associate	27222232
Progressive Transformation of Germinal Centers	Associate	18264083, 19307668, 19656156, 25400800
Purpura Thrombocytopenic Idiopathic	Stimulate	37208911
Pyruvate Carboxylase Deficiency Disease	Associate	19846886, 36752202
Schizophrenia	Stimulate	36482464
Sertoli Cell Only Syndrome	Associate	15591113, 18378569, 20533006
Sertoli Cell Only Syndrome	Stimulate	16494623, 27773559
Severe Acute Respiratory Syndrome	Stimulate	32778874
Sezary Syndrome	Associate	22918164
Spastic paraplegia 11 autosomal recessive	Associate	17542409
Squamous Cell Carcinoma of Head and Neck	Associate	26986233, 36969496
Stomach Diseases	Associate	15609396, 16772602, 9401082
Stomach Neoplasms	Associate	19337254, 29510377
T Lymphocytopenia	Associate	18166773
Takayasu Arteritis	Associate	35126357
Tuberculosis	Associate	28065665
Urinary Bladder Neoplasms	Associate	27237631
Uterine Cervicitis	Associate	32843454
Uterine Diseases	Associate	27222232
Vasculitis Leukocytoclastic Cutaneous	Associate	27180090
Vitamin D Deficiency	Associate	26931436
Vitamin D Deficiency	Stimulate	36430854