Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6038
Gene name Gene Name - the full gene name approved by the HGNC.	Ribonuclease A family member 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RNASE4
Synonyms (NCBI Gene) Gene synonyms aliases	RAB1, RNS4
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q11.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the pancreatic ribonuclease family. It plays an important role in mRNA cleavage and has marked specificity towards the 3` side of uridine nucleotides. Alternative splicing results in four transcript variants enc

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017156	hsa-miR-335-5p	Microarray	18185580
MIRT024338	hsa-miR-215-5p	Microarray	19074876
MIRT026275	hsa-miR-192-5p	Microarray	19074876
MIRT1308614	hsa-miR-3148	CLIP-seq
MIRT1308615	hsa-miR-3647-3p	CLIP-seq
MIRT1308616	hsa-miR-3973	CLIP-seq
MIRT1308617	hsa-miR-5095	CLIP-seq
MIRT1308618	hsa-miR-520g	CLIP-seq
MIRT1308619	hsa-miR-520h	CLIP-seq
MIRT1308620	hsa-miR-552	CLIP-seq
MIRT1308621	hsa-miR-556-3p	CLIP-seq
MIRT1308622	hsa-miR-561	CLIP-seq
MIRT1308623	hsa-miR-664	CLIP-seq
MIRT1308624	hsa-miR-873	CLIP-seq
MIRT1308625	hsa-miR-136	CLIP-seq
MIRT1308626	hsa-miR-3675-3p	CLIP-seq
MIRT1308617	hsa-miR-5095	CLIP-seq
MIRT1308620	hsa-miR-552	CLIP-seq
MIRT1308627	hsa-miR-654-3p	CLIP-seq
MIRT2612220	hsa-miR-302a	CLIP-seq
MIRT2612221	hsa-miR-302b	CLIP-seq
MIRT2612222	hsa-miR-302c	CLIP-seq
MIRT2612223	hsa-miR-302d	CLIP-seq
MIRT2612224	hsa-miR-302e	CLIP-seq
MIRT2612225	hsa-miR-372	CLIP-seq
MIRT2612226	hsa-miR-373	CLIP-seq
MIRT2612227	hsa-miR-3913-3p	CLIP-seq
MIRT2612228	hsa-miR-4528	CLIP-seq
MIRT2612229	hsa-miR-4536	CLIP-seq
MIRT2612230	hsa-miR-489	CLIP-seq
MIRT2612231	hsa-miR-512-3p	CLIP-seq
MIRT2612232	hsa-miR-519a	CLIP-seq
MIRT2612233	hsa-miR-519b-3p	CLIP-seq
MIRT2612234	hsa-miR-519c-3p	CLIP-seq
MIRT2612235	hsa-miR-520a-3p	CLIP-seq
MIRT2612236	hsa-miR-520b	CLIP-seq
MIRT2612237	hsa-miR-520c-3p	CLIP-seq
MIRT2612238	hsa-miR-520d-3p	CLIP-seq
MIRT2612239	hsa-miR-520e	CLIP-seq

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004522	Function	Ribonuclease A activity	NAS	7742370
GO:0004540	Function	Ribonuclease activity	IBA	21873635
GO:0004540	Function	Ribonuclease activity	IDA	3467790
GO:0005576	Component	Extracellular region	IDA	3467790
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	3467790
GO:0006379	Process	MRNA cleavage	NAS	7742370
GO:0090501	Process	RNA phosphodiester bond hydrolysis	IDA	3467790
GO:0090502	Process	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA

MIM	HGNC	e!Ensembl
601030	10047	ENSG00000258818

Protein

UniProt ID

P34096

Protein name

Ribonuclease 4 (RNase 4) (EC 3.1.27.-)

Protein function

Cleaves preferentially after uridine bases (PubMed:3467790). Has antimicrobial activity against uropathogenic E.coli (UPEC) (PubMed:33818125). Probably contributes to urinary tract sterility (PubMed:33818125). {ECO:0000269|PubMed:33818125, ECO:0

PDB

1RNF , 2RNF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00074	RnaseA	31 → 146	Pancreatic ribonuclease	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the cortical and medullary tubules of the kidney, and in the transitional epithelium of the urinary bladder (at protein level). {ECO:0000269|PubMed:30418175, ECO:0000269|PubMed:33818125}.

Sequence

MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRR
KMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNC
RYRAIASTRRVVIACEGNPQVPVHFDG

Sequence length

147

Interactions

View interactions

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Amyotrophic lateral sclerosis	Amyotrophic Lateral Sclerosis 9	rs267607084, rs312262720, rs312262752, rs121908287, rs121908288, rs29001584, rs28941475, rs121434378, rs386134173, rs386134174, rs80356730, rs80356727, rs4884357, rs80356717, rs80356733 View all (171 more)
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17013881

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	28423658
Asthma	Associate	30530896
Carcinoma Squamous Cell	Associate	28423658
Disease	Associate	30530896
Huntington Disease	Associate	29328442
Hypertension	Associate	30530896
Hypoxia	Associate	16052224
Melanoma	Associate	30925905
Neoplasms	Associate	24659782
Neurodegenerative Diseases	Associate	24659782
Skin Neoplasms	Associate	30925905
Uterine Cervical Neoplasms	Associate	28423658

RNASE4 (ribonuclease A family member 4)