Gene Gene information from NCBI Gene database.
Entrez ID 60370
Gene name Arginine vasopressin induced 1
Gene symbol AVPI1
Synonyms (NCBI Gene)
PP5395VIP32VIT32
Chromosome 10
Chromosome location 10q24.2
miRNA miRNA information provided by mirtarbase database.
124
miRTarBase ID miRNA Experiments Reference
MIRT019408 hsa-miR-148b-3p Microarray 17612493
MIRT528597 hsa-miR-5692a PAR-CLIP 22012620
MIRT528595 hsa-miR-3163 PAR-CLIP 22012620
MIRT528596 hsa-miR-95-5p PAR-CLIP 22012620
MIRT528597 hsa-miR-5692a PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21516116, 25416956, 31515488, 32296183
GO:0043410 Process Positive regulation of MAPK cascade IBA
GO:0043410 Process Positive regulation of MAPK cascade IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618537 30898 ENSG00000119986
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5T686
Protein name Arginine vasopressin-induced protein 1 (AVP-induced protein 1)
Protein function May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15063 TC1 1 75 Thyroid cancer protein 1 Family
Sequence
MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWE
CAGDHRVAEALKRLR
RKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYL
HSRKKSARIRRNWRKSGPTSYLHQIRH
Sequence length 147
Interactions View interactions