Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
60370
Gene name Gene Name - the full gene name approved by the HGNC.
Arginine vasopressin induced 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
AVPI1
Synonyms (NCBI Gene) Gene synonyms aliases
PP5395, VIP32, VIT32
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q24.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019408 hsa-miR-148b-3p Microarray 17612493
MIRT528597 hsa-miR-5692a PAR-CLIP 22012620
MIRT528595 hsa-miR-3163 PAR-CLIP 22012620
MIRT528596 hsa-miR-95-5p PAR-CLIP 22012620
MIRT528597 hsa-miR-5692a PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21516116, 25416956, 31515488, 32296183
GO:0043410 Process Positive regulation of MAPK cascade IBA
GO:0043410 Process Positive regulation of MAPK cascade IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618537 30898 ENSG00000119986
Protein
UniProt ID Q5T686
Protein name Arginine vasopressin-induced protein 1 (AVP-induced protein 1)
Protein function May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15063 TC1 1 75 Thyroid cancer protein 1 Family
Sequence
MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWE
CAGDHRVAEALKRLR
RKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYL
HSRKKSARIRRNWRKSGPTSYLHQIRH
Sequence length 147
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS