RNASE3 (ribonuclease A family member 3)

Gene

• Entrez ID: 6037
• Gene name: Ribonuclease A family member 3
• Gene symbol: RNASE3
• Synonyms (NCBI Gene): ECP, RAF1, RNS3
• Chromosome: 14
• Chromosome location: 14q11.2
• Summary: The protein encoded by this gene belongs to the pancreatic ribonuclease family, a subset of the ribonuclease A superfamily. The protein exhibits antimicrobial activity against pathogenic bacteria [provided by RefSeq, Oct 2014]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2091582	hsa-miR-1909	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001530	Function	Lipopolysaccharide binding	IDA	23992292
GO:0002227	Process	Innate immune response in mucosa	IBA
GO:0002227	Process	Innate immune response in mucosa	IDA	12860195
GO:0003676	Function	Nucleic acid binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IEA
GO:0004540	Function	RNA nuclease activity	IBA
GO:0004540	Function	RNA nuclease activity	TAS	2745977
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	10706854
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	12860195
GO:0006401	Process	RNA catabolic process	TAS	2745977
GO:0006935	Process	Chemotaxis	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019731	Process	Antibacterial humoral response	IDA	12860195
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043152	Process	Induction of bacterial agglutination	IDA	23992292
GO:0045087	Process	Innate immune response	IDA	23992292
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	23992292
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	12860195, 23992292
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12860195

Other IDs

• MIM: 131398
• HGNC: 10046
• e!Ensembl: ENSG00000169397

Protein

• UniProt ID: P12724
• Protein name: Eosinophil cationic protein (ECP) (EC 3.1.27.-) (Ribonuclease 3) (RNase 3)
• Protein function: Cytotoxin and helminthotoxin with low-efficiency ribonuclease activity. Possesses a wide variety of biological activities. Exhibits antibacterial activity, including cytoplasmic membrane depolarization of preferentially Gram-negative, but also G
• PDB: 1DYT, 1H1H, 1QMT, 2KB5, 2LVZ, 4A2O, 4A2Y, 4OWZ, 4OXB, 4OXF, 4X08
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00074	RnaseA	33 → 157	Pancreatic ribonuclease	Domain

• Sequence:

  MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNY
  RWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNI
  SNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI

• Sequence length: 160

Pathways

KEGG:

Asthma

Reactome:

Neutrophil degranulation
Antimicrobial peptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Asthma	Associate	10770817, 20534163, 29281699, 39871194	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Stimulate	26600485, 33566255	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Berylliosis	Associate	34399367	★☆☆☆☆ Found in Text Mining only
Blister	Stimulate	9602632	★☆☆☆☆ Found in Text Mining only
Bronchitis	Stimulate	12814157	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Associate	33456353	★☆☆☆☆ Found in Text Mining only
Churg Strauss Syndrome	Associate	10456969, 17437420	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Associate	20534163	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	23197886	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	32815414	★☆☆☆☆ Found in Text Mining only
Conjunctival Diseases	Associate	27929738	★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Associate	9602632	★☆☆☆☆ Found in Text Mining only
Cough	Stimulate	9648956	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Stimulate	32815414	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Stimulate	14509559	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Associate	20534163	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	36788507	★☆☆☆☆ Found in Text Mining only
Disease Progression	Stimulate	26067893	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	20534163, 26600485	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Stimulate	24814827	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity Syndrome	Associate	20534163	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	22216286	★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	35851408	★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	35851408	★☆☆☆☆ Found in Text Mining only
Fibrous Dysplasia Polyostotic	Stimulate	29896203	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Associate	10456969	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Inhibit	7129529	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Associate	35851408	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Stimulate	35851408	★☆☆☆☆ Found in Text Mining only
Infections	Associate	26600485, 27696685	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	10836324	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	31128376, 39911041	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	23197886	★☆☆☆☆ Found in Text Mining only
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	35111390	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Stimulate	10456969	★☆☆☆☆ Found in Text Mining only
Malaria	Associate	29402293, 33113080	★☆☆☆☆ Found in Text Mining only
Malaria Cerebral	Associate	22216286, 29402293, 33113080	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	26067893	★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	27717558, 35747690	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Associate	26730743	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	30868060	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23197886	★☆☆☆☆ Found in Text Mining only
Nose Diseases	Stimulate	15463816	★☆☆☆☆ Found in Text Mining only
Nose Diseases	Associate	25573100	★☆☆☆☆ Found in Text Mining only
Pancreatic Intraductal Neoplasms	Associate	22355676	★☆☆☆☆ Found in Text Mining only
Pemphigoid Bullous	Associate	28684769, 9602632	★☆☆☆☆ Found in Text Mining only
Periodontitis	Associate	29520824	★☆☆☆☆ Found in Text Mining only
Peritonitis	Stimulate	31123272	★☆☆☆☆ Found in Text Mining only
Rhinitis	Stimulate	10543283, 36276929	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Associate	34399367	★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Associate	39661012	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	34585646	★☆☆☆☆ Found in Text Mining only
upper airway cough syndrome	Stimulate	36276929	★☆☆☆☆ Found in Text Mining only