Gene Gene information from NCBI Gene database.
Entrez ID 602
Gene name BCL3 transcription coactivator
Gene symbol BCL3
Synonyms (NCBI Gene)
BCL4D19S37
Chromosome 19
Chromosome location 19q13.32
Summary This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those f
miRNA miRNA information provided by mirtarbase database.
300
miRTarBase ID miRNA Experiments Reference
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT030231 hsa-miR-26b-5p Microarray 19088304
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
NFKB1 Activation 11387332
RELA Activation 11387332
TP53 Repression 12808109
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
65
GO ID Ontology Definition Evidence Reference
GO:0001818 Process Negative regulation of cytokine production IEA
GO:0002268 Process Follicular dendritic cell differentiation IEA
GO:0002315 Process Marginal zone B cell differentiation IEA
GO:0002455 Process Humoral immune response mediated by circulating immunoglobulin IEA
GO:0002467 Process Germinal center formation IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
109560 998 ENSG00000069399
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20749
Protein name B-cell lymphoma 3 protein (BCL-3) (Proto-oncogene BCL3)
Protein function Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcrip
PDB 1K1A , 1K1B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 134 170 Ankyrin repeat Repeat
PF00023 Ank 172 203 Ankyrin repeat Repeat
PF00023 Ank 241 273 Ankyrin repeat Repeat
PF00023 Ank 275 306 Ankyrin repeat Repeat
Sequence
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDR
HGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQM
YSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
Sequence length 454
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  C-type lectin receptor signaling pathway
TNF signaling pathway