Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	602
Gene name Gene Name - the full gene name approved by the HGNC.	BCL3 transcription coactivator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BCL3
Synonyms (NCBI Gene) Gene synonyms aliases	BCL4, D19S37
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those f

Show/Hide all(300)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT006500	hsa-miR-125b-5p	Luciferase reporter assay	20658525
MIRT030231	hsa-miR-26b-5p	Microarray	19088304
MIRT462839	hsa-miR-4426	PAR-CLIP	23592263
MIRT462838	hsa-miR-4647	PAR-CLIP	23592263
MIRT462837	hsa-miR-4662b	PAR-CLIP	23592263
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT462835	hsa-miR-7161-3p	PAR-CLIP	23592263
MIRT462834	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT462833	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT462832	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT462831	hsa-miR-6837-3p	PAR-CLIP	23592263
MIRT462830	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462827	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT462825	hsa-miR-4281	PAR-CLIP	23592263
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462823	hsa-miR-133a-3p	PAR-CLIP	23592263
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT462821	hsa-miR-197-5p	PAR-CLIP	23592263
MIRT462820	hsa-miR-3132	PAR-CLIP	23592263
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	23592263
MIRT200615	hsa-miR-3115	PAR-CLIP	23592263
MIRT252930	hsa-miR-4666b	PAR-CLIP	23592263
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	23592263
MIRT462819	hsa-miR-3936	PAR-CLIP	23592263
MIRT252920	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT252921	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT252921	hsa-miR-19b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27572553
MIRT252921	hsa-miR-19b-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	27572553
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT462821	hsa-miR-197-5p	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT200615	hsa-miR-3115	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462820	hsa-miR-3132	PAR-CLIP	26701625
MIRT462827	hsa-miR-328-5p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT462819	hsa-miR-3936	PAR-CLIP	26701625
MIRT252930	hsa-miR-4666b	PAR-CLIP	26701625
MIRT252930	hsa-miR-4666b	PAR-CLIP	26701625
MIRT462830	hsa-miR-486-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	26701625
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	26701625
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	26701625
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	26701625
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	26701625
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	26701625
MIRT462839	hsa-miR-4426	PAR-CLIP	23592263
MIRT462838	hsa-miR-4647	PAR-CLIP	23592263
MIRT462837	hsa-miR-4662b	PAR-CLIP	23592263
MIRT462836	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT462835	hsa-miR-7161-3p	PAR-CLIP	23592263
MIRT462834	hsa-miR-4671-5p	PAR-CLIP	23592263
MIRT462833	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT462832	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT462831	hsa-miR-6837-3p	PAR-CLIP	23592263
MIRT462830	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT462829	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT462828	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT462827	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT462826	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT462825	hsa-miR-4281	PAR-CLIP	23592263
MIRT462824	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT462823	hsa-miR-133a-3p	PAR-CLIP	23592263
MIRT200619	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT200620	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT462822	hsa-miR-3934-3p	PAR-CLIP	23592263
MIRT200622	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT200626	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT200627	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT200621	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT462821	hsa-miR-197-5p	PAR-CLIP	23592263
MIRT462820	hsa-miR-3132	PAR-CLIP	23592263
MIRT200623	hsa-miR-6772-5p	PAR-CLIP	23592263
MIRT200615	hsa-miR-3115	PAR-CLIP	23592263
MIRT252930	hsa-miR-4666b	PAR-CLIP	23592263
MIRT200614	hsa-miR-1229-5p	PAR-CLIP	23592263
MIRT462819	hsa-miR-3936	PAR-CLIP	23592263
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819327	hsa-miR-1256	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819334	hsa-miR-19a	CLIP-seq
MIRT819335	hsa-miR-19b	CLIP-seq
MIRT819336	hsa-miR-218	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819342	hsa-miR-3182	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819345	hsa-miR-3687	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819348	hsa-miR-412	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819353	hsa-miR-4442	CLIP-seq
MIRT819354	hsa-miR-4451	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT819361	hsa-miR-4687-3p	CLIP-seq
MIRT819362	hsa-miR-4693-3p	CLIP-seq
MIRT819363	hsa-miR-4698	CLIP-seq
MIRT819364	hsa-miR-4720-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819369	hsa-miR-4804-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819372	hsa-miR-520d-5p	CLIP-seq
MIRT819373	hsa-miR-524-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819377	hsa-miR-556-3p	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819382	hsa-miR-636	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT1942119	hsa-miR-3156-5p	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819326	hsa-miR-1224-3p	CLIP-seq
MIRT819327	hsa-miR-1256	CLIP-seq
MIRT819328	hsa-miR-1273f	CLIP-seq
MIRT819329	hsa-miR-1275	CLIP-seq
MIRT819330	hsa-miR-128	CLIP-seq
MIRT2180987	hsa-miR-1293	CLIP-seq
MIRT819331	hsa-miR-1343	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819333	hsa-miR-1973	CLIP-seq
MIRT819334	hsa-miR-19a	CLIP-seq
MIRT819335	hsa-miR-19b	CLIP-seq
MIRT819336	hsa-miR-218	CLIP-seq
MIRT819337	hsa-miR-27a	CLIP-seq
MIRT819338	hsa-miR-27b	CLIP-seq
MIRT819339	hsa-miR-296-3p	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT2180988	hsa-miR-299-3p	CLIP-seq
MIRT2180989	hsa-miR-3126-3p	CLIP-seq
MIRT819340	hsa-miR-3154	CLIP-seq
MIRT1942119	hsa-miR-3156-5p	CLIP-seq
MIRT819341	hsa-miR-3180-5p	CLIP-seq
MIRT819342	hsa-miR-3182	CLIP-seq
MIRT819343	hsa-miR-3192	CLIP-seq
MIRT819344	hsa-miR-3199	CLIP-seq
MIRT819345	hsa-miR-3687	CLIP-seq
MIRT2180990	hsa-miR-3688-3p	CLIP-seq
MIRT819346	hsa-miR-3689a-3p	CLIP-seq
MIRT819347	hsa-miR-3689c	CLIP-seq
MIRT819348	hsa-miR-412	CLIP-seq
MIRT819349	hsa-miR-4251	CLIP-seq
MIRT819350	hsa-miR-4324	CLIP-seq
MIRT819351	hsa-miR-4419a	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819353	hsa-miR-4442	CLIP-seq
MIRT819355	hsa-miR-4454	CLIP-seq
MIRT2180991	hsa-miR-4483	CLIP-seq
MIRT819356	hsa-miR-4510	CLIP-seq
MIRT819357	hsa-miR-4515	CLIP-seq
MIRT819358	hsa-miR-4525	CLIP-seq
MIRT819359	hsa-miR-4665-5p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT2180992	hsa-miR-4694-3p	CLIP-seq
MIRT819363	hsa-miR-4698	CLIP-seq
MIRT819364	hsa-miR-4720-3p	CLIP-seq
MIRT819365	hsa-miR-4723-5p	CLIP-seq
MIRT819366	hsa-miR-4728-5p	CLIP-seq
MIRT819367	hsa-miR-4731-5p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT2180993	hsa-miR-4802-3p	CLIP-seq
MIRT819369	hsa-miR-4804-3p	CLIP-seq
MIRT819370	hsa-miR-513a-5p	CLIP-seq
MIRT819371	hsa-miR-520a-5p	CLIP-seq
MIRT819374	hsa-miR-525-5p	CLIP-seq
MIRT819375	hsa-miR-548q	CLIP-seq
MIRT819376	hsa-miR-550a	CLIP-seq
MIRT819378	hsa-miR-563	CLIP-seq
MIRT2180994	hsa-miR-576-3p	CLIP-seq
MIRT819379	hsa-miR-580	CLIP-seq
MIRT819380	hsa-miR-615-5p	CLIP-seq
MIRT819381	hsa-miR-625	CLIP-seq
MIRT819382	hsa-miR-636	CLIP-seq
MIRT2180995	hsa-miR-7	CLIP-seq
MIRT2180996	hsa-miR-935	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq
MIRT819325	hsa-miR-1207-5p	CLIP-seq
MIRT819332	hsa-miR-1909	CLIP-seq
MIRT1942118	hsa-miR-296-5p	CLIP-seq
MIRT819352	hsa-miR-4436b-3p	CLIP-seq
MIRT819360	hsa-miR-4667-3p	CLIP-seq
MIRT1942120	hsa-miR-4749-3p	CLIP-seq
MIRT819368	hsa-miR-4763-3p	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
NFKB1	Activation	11387332
RELA	Activation	11387332
TP53	Repression	12808109

Show/Hide all(65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002268	Process	Follicular dendritic cell differentiation	IEA
GO:0002315	Process	Marginal zone B cell differentiation	IEA
GO:0002455	Process	Humoral immune response mediated by circulating immunoglobulin	IEA
GO:0002467	Process	Germinal center formation	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	16306601
GO:0005515	Function	Protein binding	IPI	10362352, 16099425, 16280327, 21988832, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8196632, 16280327, 16306601
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11387332
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006606	Process	Protein import into nucleus	IDA	8196632
GO:0006915	Process	Apoptotic process	IEA
GO:0006950	Process	Response to stress	IEA
GO:0006974	Process	DNA damage response	IDA	16384933
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	8196632
GO:0009615	Process	Response to virus	IDA	16306601
GO:0010225	Process	Response to UV-C	IDA	16384933
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0019730	Process	Antimicrobial humoral response	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030330	Process	DNA damage response, signal transduction by p53 class mediator	IMP	16384933
GO:0030496	Component	Midbody	IDA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	16306601
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	16306601
GO:0032717	Process	Negative regulation of interleukin-8 production	IMP	16306601
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032733	Process	Positive regulation of interleukin-10 production	IEA
GO:0032991	Component	Protein-containing complex	IDA	16280327
GO:0032996	Component	Bcl3-Bcl10 complex	IDA	16280327
GO:0033257	Component	Bcl3/NF-kappaB2 complex	IBA
GO:0033257	Component	Bcl3/NF-kappaB2 complex	IDA	9407099
GO:0036064	Component	Ciliary basal body	IDA
GO:0042088	Process	T-helper 1 type immune response	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	16384933
GO:0042826	Function	Histone deacetylase binding	IBA
GO:0042826	Function	Histone deacetylase binding	IPI	16306601
GO:0042832	Process	Defense response to protozoan	IEA
GO:0042981	Process	Regulation of apoptotic process	IBA
GO:0042981	Process	Regulation of apoptotic process	IDA	16732314
GO:0043066	Process	Negative regulation of apoptotic process	IDA	16384933
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045064	Process	T-helper 2 cell differentiation	IEA
GO:0045727	Process	Positive regulation of translation	IMP	16384933
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16306601
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	16384933
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046426	Process	Negative regulation of receptor signaling pathway via JAK-STAT	IMP	16306601
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048536	Process	Spleen development	IEA
GO:0051101	Process	Regulation of DNA binding	IEP	9407099
GO:0051707	Process	Response to other organism	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	8196632, 11387332, 16108830, 16306601
GO:1901222	Process	Regulation of non-canonical NF-kappaB signal transduction	IEP	8196632

MIM	HGNC	e!Ensembl
109560	998	ENSG00000069399

Protein

UniProt ID

P20749

Protein name

B-cell lymphoma 3 protein (BCL-3) (Proto-oncogene BCL3)

Protein function

Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcrip

PDB

1K1A , 1K1B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00023	Ank	134 → 170	Ankyrin repeat	Repeat
PF00023	Ank	172 → 203	Ankyrin repeat	Repeat
PF00023	Ank	241 → 273	Ankyrin repeat	Repeat
PF00023	Ank	275 → 306	Ankyrin repeat	Repeat

Sequence

MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS

Sequence length

454

Interactions

View interactions

	KEGG
	C-type lectin receptor signaling pathway TNF signaling pathway

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Asthma	Asthma	N/A	N/A	GWAS
Eczema	Eczema	N/A	N/A	GWAS
Hyperlipidemia	Familial combined hyperlipidemia defined by Brunzell criteria	N/A	N/A	GWAS

Show/Hide Text Mining Associations (60)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Stimulate	29473241
Adenocarcinoma	Associate	34088830
Aneuploidy	Associate	20731879
Arthritis Rheumatoid	Associate	30753680
Barrett Esophagus	Associate	29473241
Blood Platelet Disorders	Stimulate	9885253
Brain Neoplasms	Associate	29287594
Breast Neoplasms	Associate	26515727, 29287594, 29339359, 35020071
Calcinosis Cutis	Associate	20414006
Carcinogenesis	Associate	20414006
Carcinoma Hepatocellular	Associate	31937236
Carcinoma Non Small Cell Lung	Associate	31586084
Carcinoma Renal Cell	Associate	27779101
Cardiomyopathies	Associate	25884818
Cleft Palate	Associate	19229118, 7668251
Colorectal Neoplasms	Associate	20414006, 25929479, 30792270
Colorectal Neoplasms	Stimulate	32355204
Coronavirus Infections	Associate	33968364
COVID 19	Associate	34312772
Dermatitis Atopic	Stimulate	19282837
Dermatitis Atopic	Associate	19809421
Dyslipidemias	Associate	29670124
Enteropathy Associated T Cell Lymphoma	Associate	15105810
Episodic Kinesigenic Dyskinesia 2	Associate	17129229
Familial cylindromatosis	Inhibit	22832488
Glioblastoma	Associate	29973405, 31390836, 35488886
Glioma	Associate	29973405
Hereditary leiomyomatosis and renal cell cancer	Associate	16123212
Hodgkin Disease	Associate	15105810, 16123212, 21385932
Inflammation	Associate	37151134
Leukemia	Associate	20731879
Leukemia B Cell	Associate	2682663, 38538317
Leukemia Lymphocytic Chronic B Cell	Associate	12835724, 15105810, 23432949, 30357752, 30575108, 37560801, 9694711
Leukemia Myeloid Acute	Inhibit	30357752
Leukemia Prolymphocytic T Cell	Associate	17129229
Lymphoma	Associate	37560801
Lymphoma B Cell	Associate	15105810, 17129229, 37560801, 39327470, 8400234
Lymphoma B Cell Marginal Zone	Associate	37560801
Lymphoma Extranodal NK T Cell	Associate	15105810
Lymphoma Follicular	Associate	15105810, 8400234
Lymphoma Large B Cell Diffuse	Associate	14556665, 15105810, 38538317
Lymphoma Large Cell Anaplastic	Associate	12456498, 15105810, 16108830, 16123212
Lymphoma Mantle Cell	Associate	15105810
Lymphoma Non Hodgkin	Associate	12835724, 16123212
Lymphoma T Cell	Associate	15105810
Lymphoma T Cell Peripheral	Associate	15105810, 16123212
Lymphoproliferative Disorders	Associate	16418595
Melanoma	Associate	18668140, 39327470
Mesothelioma Malignant	Associate	34088830
Multiple Myeloma	Associate	19191868, 37610069
Mycosis Fungoides	Associate	15105810
Nasopharyngeal Carcinoma	Associate	17626640, 18367518
Neoplasms	Associate	19806201, 20731879, 20974051, 25929479, 30135206, 30289427, 30357752, 30792270, 35020071, 37560801
Neurodegenerative Diseases	Stimulate	34312772
Orofacial Cleft 1	Associate	7668251
Ovarian Neoplasms	Associate	30135206, 37151134
Retinal Dysplasia	Associate	29473241
Thyroid Cancer Papillary	Associate	34315405
Triple Negative Breast Neoplasms	Associate	30289427
Uterine Cervical Neoplasms	Associate	20974051

BCL3 (BCL3 transcription coactivator)