Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
602
Gene name Gene Name - the full gene name approved by the HGNC.
BCL3 transcription coactivator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BCL3
Synonyms (NCBI Gene) Gene synonyms aliases
BCL4, D19S37
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a proto-oncogene candidate. It is identified by its translocation into the immunoglobulin alpha-locus in some cases of B-cell leukemia. The protein encoded by this gene contains seven ankyrin repeats, which are most closely related to those f
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT006500 hsa-miR-125b-5p Luciferase reporter assay 20658525
MIRT030231 hsa-miR-26b-5p Microarray 19088304
Transcription factors
Transcription factor Regulation Reference
NFKB1 Activation 11387332
RELA Activation 11387332
TP53 Repression 12808109
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0002268 Process Follicular dendritic cell differentiation IEA
GO:0002315 Process Marginal zone B cell differentiation IEA
GO:0002455 Process Humoral immune response mediated by circulating immunoglobulin IEA
GO:0002467 Process Germinal center formation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
109560 998 ENSG00000069399
Protein
UniProt ID P20749
Protein name B-cell lymphoma 3 protein (BCL-3) (Proto-oncogene BCL3)
Protein function Contributes to the regulation of transcriptional activation of NF-kappa-B target genes. In the cytoplasm, inhibits the nuclear translocation of the NF-kappa-B p50 subunit. In the nucleus, acts as transcriptional activator that promotes transcrip
PDB 1K1A , 1K1B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00023 Ank 134 170 Ankyrin repeat Repeat
PF00023 Ank 172 203 Ankyrin repeat Repeat
PF00023 Ank 241 273 Ankyrin repeat Repeat
PF00023 Ank 275 306 Ankyrin repeat Repeat
Sequence
MPRCPAGAMDEGPVDLRTRPKAAGLPGAALPLRKRPLRAPSPEPAAPRGAAGLVVPLDPL
RGGCDLPAVPGPPHGLARPEALYYPGALLPLYPTRAMGSPFPLVNLPTPLYPMMCPMEHP
LSADIAMATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQQGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVTAGASPMALDR
HGQTAAHLACEHRSPTCLRALLDSAAPGTLDLEARNY
DGLTALHVAVNTECQETVQLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQM
YSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRG
KATRPASTSQPDPSPDRSANTSPESSSRLSSNGLLSASPSSSPSQSPPRDPPGFPMAPPN
FFLPSPSPPAFLPFAGVLRGPGRPVPPSPAPGGS
Sequence length 454
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  C-type lectin receptor signaling pathway
TNF signaling pathway
 
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
19734903, 30805717, 24755620, 29777097, 30617256, 21460841, 22832961
Unknown
Disease term Disease name Evidence References Source
Atherosclerosis Atherosclerosis 25374339 ClinVar
Eczema Eczema GWAS
Hyperlipidemia Hyperlipidemia GWAS
Asthma Asthma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 29473241
Adenocarcinoma Associate 34088830
Aneuploidy Associate 20731879
Arthritis Rheumatoid Associate 30753680
Barrett Esophagus Associate 29473241
Blood Platelet Disorders Stimulate 9885253
Brain Neoplasms Associate 29287594
Breast Neoplasms Associate 26515727, 29287594, 29339359, 35020071
Calcinosis Cutis Associate 20414006
Carcinogenesis Associate 20414006