Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6015
Gene name	Ring finger protein 1
Gene symbol	RING1
Synonyms (NCBI Gene)	RING1ARNF1
Chromosome	6
Chromosome location	6p21.32
Summary	This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associate

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020727	hsa-miR-155-5p	Proteomics	18668040
MIRT042052	hsa-miR-484	CLASH	23622248
MIRT2315812	hsa-miR-1197	CLIP-seq
MIRT2315813	hsa-miR-1275	CLIP-seq
MIRT2315814	hsa-miR-1587	CLIP-seq
MIRT2315815	hsa-miR-320e	CLIP-seq
MIRT2315816	hsa-miR-342-5p	CLIP-seq
MIRT2315817	hsa-miR-3652	CLIP-seq
MIRT2315818	hsa-miR-378g	CLIP-seq
MIRT2315819	hsa-miR-4430	CLIP-seq
MIRT2315820	hsa-miR-4436a	CLIP-seq
MIRT2315821	hsa-miR-4492	CLIP-seq
MIRT2315822	hsa-miR-4498	CLIP-seq
MIRT2315823	hsa-miR-4505	CLIP-seq
MIRT2315824	hsa-miR-4525	CLIP-seq
MIRT2315825	hsa-miR-4651	CLIP-seq
MIRT2315826	hsa-miR-4656	CLIP-seq
MIRT2315827	hsa-miR-4664-5p	CLIP-seq
MIRT2315828	hsa-miR-4665-5p	CLIP-seq
MIRT2315829	hsa-miR-4675	CLIP-seq
MIRT2315830	hsa-miR-4723-5p	CLIP-seq
MIRT2315831	hsa-miR-4731-5p	CLIP-seq
MIRT2315832	hsa-miR-4741	CLIP-seq
MIRT2315833	hsa-miR-608	CLIP-seq
MIRT2315834	hsa-miR-625	CLIP-seq
MIRT2315835	hsa-miR-637	CLIP-seq
MIRT2315836	hsa-miR-762	CLIP-seq
MIRT2315813	hsa-miR-1275	CLIP-seq
MIRT2315815	hsa-miR-320e	CLIP-seq
MIRT2315816	hsa-miR-342-5p	CLIP-seq
MIRT2315824	hsa-miR-4525	CLIP-seq
MIRT2315825	hsa-miR-4651	CLIP-seq
MIRT2315827	hsa-miR-4664-5p	CLIP-seq
MIRT2315828	hsa-miR-4665-5p	CLIP-seq
MIRT2315830	hsa-miR-4723-5p	CLIP-seq
MIRT2315831	hsa-miR-4731-5p	CLIP-seq
MIRT2315833	hsa-miR-608	CLIP-seq
MIRT2315834	hsa-miR-625	CLIP-seq
MIRT2315835	hsa-miR-637	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IBA
GO:0000151	Component	Ubiquitin ligase complex	IEA
GO:0001739	Component	Sex chromatin	IEA
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	15386022, 16189514, 16943429, 17070805, 19549727, 19636380, 20601937, 21282530, 21516116, 22493164, 22897849, 24981860, 25416956, 26496610, 27505670, 27705803, 28514442, 28839133, 29187402, 31839203, 32296183, 32814053, 33961781, 34316702, 35271311
GO:0005634	Component	Nucleus	IDA	9199346, 21282530
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	16943429
GO:0008270	Function	Zinc ion binding	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031519	Component	PcG protein complex	IBA
GO:0031519	Component	PcG protein complex	IDA	16943429, 21282530
GO:0031519	Component	PcG protein complex	IEA
GO:0035102	Component	PRC1 complex	IDA	12167701, 19636380
GO:0035102	Component	PRC1 complex	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	9199346
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IEA

MIM	HGNC	e!Ensembl
602045	10018	ENSG00000204227

Q06587

Protein name

E3 ubiquitin-protein ligase RING1 (EC 2.3.2.27) (Polycomb complex protein RING1) (RING finger protein 1) (RING-type E3 ubiquitin transferase RING1) (Really interesting new gene 1 protein)

Protein function

Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00097	zf-C3HC4	48 → 87	Zinc finger, C3HC4 type (RING finger)	Domain
PF16207	RAWUL	282 → 400	RAWUL domain RING finger- and WD40-associated ubiquitin-like	Domain

Sequence

MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMT
TKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAH
QDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGE
GDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLG
GGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLA
LRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQ
YTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK

Sequence length

406

Interactions

View interactions

	KEGG		Reactome
	Polycomb repressive complex		Oxidative Stress Induced Senescence SUMOylation of DNA damage response and repair proteins SUMOylation of transcription cofactors SUMOylation of chromatin organization proteins SUMOylation of RNA binding proteins RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known Regulation of PTEN gene transcription Transcriptional Regulation by E2F6

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	26141041	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Stimulate	24414991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	26141041	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Inhibit	16528373	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	9199346	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	38219048	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	33446692	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary leiomyomatosis and renal cell cancer	Associate	14982841	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoma Adult T Cell	Associate	21228036	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Stimulate	24414991	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	21148756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	11298590	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	21148756	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	28832687	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	24414991, 26141041	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	28028181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Associate	9199346	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	24414991, 26141041	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Inhibit	16528373	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	18984978, 24414991, 26141041	★★★★★ ★☆☆☆☆ Found in Text Mining only

RING1 (ring finger protein 1)