RIT2 (Ras like without CAAX 2)

Gene

• Entrez ID: 6014
• Gene name: Ras like without CAAX 2
• Gene symbol: RIT2
• Synonyms (NCBI Gene): RIBA, RIN, ROC2
• Chromosome: 18
• Chromosome location: 18q12.3
• Summary: RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1307789	hsa-miR-3163	CLIP-seq
MIRT1307790	hsa-miR-3919	CLIP-seq
MIRT1307791	hsa-miR-4282	CLIP-seq
MIRT1307792	hsa-miR-4756-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0003924	Function	GTPase activity	NAS	8824319
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	21957239, 32296183
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IDA	8918462
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	ISS
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IDA	16122393
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16122393, 21957239
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8824319
GO:0007165	Process	Signal transduction	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	NAS	8824319
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	ISS
GO:0007268	Process	Chemical synaptic transmission	TAS	8918462
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IGI	16157584
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0030100	Process	Regulation of endocytosis	IMP	21957239
GO:0030215	Function	Semaphorin receptor binding	IPI	16122393
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032507	Process	Maintenance of protein location in cell	IMP	21957239
GO:0035556	Process	Intracellular signal transduction	IDA	21957239
GO:0042802	Function	Identical protein binding	IDA	21957239
GO:0043005	Component	Neuron projection	IDA	21957239
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0045121	Component	Membrane raft	IDA	21957239
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	ISS
GO:0097447	Component	Dendritic tree	IEA
GO:0097447	Component	Dendritic tree	ISS

Other IDs

• MIM: 609592
• HGNC: 10017
• e!Ensembl: ENSG00000152214

Protein

• UniProt ID: Q99578
• Protein name: GTP-binding protein Rit2 (EC 3.6.5.2) (Ras-like protein expressed in neurons) (Ras-like without CAAX protein 2)
• Protein function: Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	22 → 183	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Neuron-specific.
• Sequence:

  MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
  VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV
  RHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVRE
  IRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT

• Sequence length: 217