Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6014
Gene name Gene Name - the full gene name approved by the HGNC.	Ras like without CAAX 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIT2
Synonyms (NCBI Gene) Gene synonyms aliases	RIBA, RIN, ROC2
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments
MIRT1307789	hsa-miR-3163	CLIP-seq
MIRT1307790	hsa-miR-3919	CLIP-seq
MIRT1307791	hsa-miR-4282	CLIP-seq
MIRT1307792	hsa-miR-4756-3p	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	ISS
GO:0001932	Process	Regulation of protein phosphorylation	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003924	Function	GTPase activity	IBA	21873635
GO:0003924	Function	GTPase activity	ISS
GO:0003924	Function	GTPase activity	NAS	8824319
GO:0005515	Function	Protein binding	IPI	21957239, 32296183
GO:0005516	Function	Calmodulin binding	IBA	21873635
GO:0005516	Function	Calmodulin binding	IDA	8918462
GO:0005516	Function	Calmodulin binding	ISS
GO:0005525	Function	GTP binding	IBA	21873635
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IDA	16122393
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	16122393, 21957239
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8824319
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007264	Process	Small GTPase mediated signal transduction	NAS	8824319
GO:0007265	Process	Ras protein signal transduction	IBA	21873635
GO:0007265	Process	Ras protein signal transduction	ISS
GO:0007268	Process	Chemical synaptic transmission	TAS	8918462
GO:0010976	Process	Positive regulation of neuron projection development	IBA	21873635
GO:0010976	Process	Positive regulation of neuron projection development	IGI	16157584
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0019003	Function	GDP binding	IBA	21873635
GO:0030100	Process	Regulation of endocytosis	IMP	21957239
GO:0030215	Function	Semaphorin receptor binding	IPI	16122393
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032507	Process	Maintenance of protein location in cell	IMP	21957239
GO:0035556	Process	Intracellular signal transduction	IDA	21957239
GO:0042802	Function	Identical protein binding	IDA	21957239
GO:0043005	Component	Neuron projection	IDA	21957239
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044297	Component	Cell body	ISS
GO:0045121	Component	Membrane raft	IDA	21957239
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	ISS
GO:0097447	Component	Dendritic tree	ISS

MIM	HGNC	e!Ensembl
609592	10017	ENSG00000152214

Protein

UniProt ID

Q99578

Protein name

GTP-binding protein Rit2 (EC 3.6.5.2) (Ras-like protein expressed in neurons) (Ras-like without CAAX protein 2)

Protein function

Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	22 → 183	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Neuron-specific.

Sequence

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV
RHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVRE
IRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT

Sequence length

217

Interactions

View interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Colorectal neoplasms	Secondary malignant neoplasm of colon and/or rectum	rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049 View all (1682 more)	30738427
Narcolepsy	Narcolepsy	rs104894574, rs387906655	19629137
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	27182965, 21738487, 25064009, 28892059, 22451204
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22491018

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	Source
Unknown
Diabetes	Diabetes		GWAS
Parkinson Disease	Parkinson Disease		GWAS
Colorectal Cancer	Colorectal Cancer	In summary, our data strongly demonstrated that upregulation of GRB7 conferred MEKi resistance in CRC cells with KRAS mutations by mediating RTK signaling through the recruitment of PLK1.	GWAS, CBGDA
Metabolic Syndrome	Metabolic Syndrome		GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Colorectal Neoplasms	Associate	36849394
Parkinson Disease	Associate	23071545

RIT2 (Ras like without CAAX 2)