Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	6014
Gene name Gene Name - the full gene name approved by the HGNC.	Ras like without CAAX 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RIT2
Synonyms (NCBI Gene) Gene synonyms aliases	RIBA, RIN, ROC2
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	RIN belongs to the RAS (HRAS; MIM 190020) superfamily of small GTPases (Shao et al., 1999 [PubMed 10545207]).[supplied by OMIM, Mar 2008]

Show/Hide all(4)

miRTarBase ID	miRNA	Experiments
MIRT1307789	hsa-miR-3163	CLIP-seq
MIRT1307790	hsa-miR-3919	CLIP-seq
MIRT1307791	hsa-miR-4282	CLIP-seq
MIRT1307792	hsa-miR-4756-3p	CLIP-seq

Show/Hide all(63)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	ISS
GO:0000166	Function	Nucleotide binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	ISS
GO:0003924	Function	GTPase activity	NAS	8824319
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	21957239, 32296183
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IDA	8918462
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	ISS
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	ISS
GO:0005634	Component	Nucleus	IDA	16122393
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16122393, 21957239
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8824319
GO:0007165	Process	Signal transduction	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	NAS	8824319
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0007265	Process	Ras protein signal transduction	ISS
GO:0007268	Process	Chemical synaptic transmission	TAS	8918462
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IGI	16157584
GO:0010976	Process	Positive regulation of neuron projection development	ISS
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019003	Function	GDP binding	IBA
GO:0030100	Process	Regulation of endocytosis	IMP	21957239
GO:0030215	Function	Semaphorin receptor binding	IPI	16122393
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IEA
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	ISS
GO:0032507	Process	Maintenance of protein location in cell	IMP	21957239
GO:0035556	Process	Intracellular signal transduction	IDA	21957239
GO:0042802	Function	Identical protein binding	IDA	21957239
GO:0043005	Component	Neuron projection	IDA	21957239
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0045121	Component	Membrane raft	IDA	21957239
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	IEA
GO:0050848	Process	Regulation of calcium-mediated signaling	ISS
GO:0097447	Component	Dendritic tree	IEA
GO:0097447	Component	Dendritic tree	ISS

MIM	HGNC	e!Ensembl
609592	10017	ENSG00000152214

Protein

UniProt ID

Q99578

Protein name

GTP-binding protein Rit2 (EC 3.6.5.2) (Ras-like protein expressed in neurons) (Ras-like without CAAX protein 2)

Protein function

Binds and exchanges GTP and GDP. Binds and modulates the activation of POU4F1 as gene expression regulator.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	22 → 183	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Neuron-specific.

Sequence

MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQ
VRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQV
RHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVRE
IRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT

Sequence length

217

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Colorectal Cancer	Metastasis in stage I-III microsatellite instability low/stable colorectal cancer (time to event)	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Metabolic Syndrome	Metabolic syndrome	N/A	N/A	GWAS
Parkinson Disease	Parkinson's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Colorectal Neoplasms	Associate	36849394
Parkinson Disease	Associate	23071545

RIT2 (Ras like without CAAX 2)